(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE242

MICSR_1.PE242        Location/Qualifiers
FT   CDS_pept        join(489452..489505,489994..490830)
FT                   /codon_start=1
FT                   /gene_family="HOG000227586" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636582"
FT                   /orf_name="MICPUN_107893"
FT                   /product="Predicted protein"
FT                   /function="catalytic activity"
FT                   /biological_process="pyridoxal phosphate biosynthetic
FT                   process"
FT                   /protein_id="ACO61709.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0042823"
FT                   /db_xref="HOGENOM:HBG292342"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniParc:UPI000199ABB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B9"
FT                   /transl_table=1
FT                   /translation="MATEAQKGTFAVKVGLAQMLKGGVIMDVVNVEQARIAEEAGAVAV
FT                   MALERVPADIRKDGGVARMSDPTMIKAIKEAVTIPVMAKARIGHFVEAQVLESIGIDYI
FT                   DESEVLTPADEINHINKHNFKVPVLCGCRDLGEALRRIAEGSSMIRTKGEAGTGNVVEA
FT                   VRHCRAVMGDIRRLQSMDDDEIFVYAKEIRAPLELVKQTKTLGRLPVVNFAAGGVATPA
FT                   DAALMMQLGMDGVFVGSGIFKSGDPAKRARAIVQAVTHYNDPKIIAEVSQGLGEAMVGI
FT                   DCKEMHFTSYAARSE"
     atggctaccg aggctcagaa gggcactttc gccgtcaagg tcggccttgc gcagatgctc        60
     aagggtggcg tcatcatgga cgtcgtcaac gtggagcagg cgcgcatcgc cgaggaggct       120
     ggcgccgtcg ccgtcatggc cctcgagcgc gtcccggccg acatccgcaa ggacggtggc       180
     gtcgcacgca tgtccgaccc caccatgatc aaggcgatca aggaggcggt caccatccct       240
     gtcatggcca aggcgcgcat cggccatttc gtcgaggcgc aggtgctcga gtccatcggc       300
     atcgattaca tcgacgagtc cgaggtgctc accccggcgg acgagatcaa ccacatcaac       360
     aagcacaact tcaaggttcc tgtgctctgc ggctgccgcg acctcggcga ggccctccgc       420
     cgcatcgcgg agggttcctc catgatccgc accaagggcg aggcgggaac cggcaacgtc       480
     gtcgaggcgg ttcgccactg ccgcgccgtg atgggcgaca ttcgcaggct ccagtccatg       540
     gacgacgacg agatcttcgt ctacgccaag gagatccgcg cccccctcga gctcgtcaag       600
     cagaccaaga ccctcggccg cctccccgtc gtcaactttg ccgcgggcgg cgtcgccacc       660
     cccgcggatg ccgcgctcat gatgcagctc ggcatggacg gcgtctttgt cggctccggc       720
     atcttcaagt cgggcgatcc cgccaagcgc gcgagggcca tcgtccaggc ggtgacccac       780
     tacaacgacc ccaagatcat cgcggaggtg tcccagggcc tgggcgaggc catggtgggc       840
     atcgactgca aggagatgca cttcacctcc tacgccgcgc gctccgagtg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page