(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE243

MICSR_1.PE243        Location/Qualifiers
FT   CDS_pept        join(491157..491222,491319..492827)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636583"
FT                   /orf_name="MICPUN_56816"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61710.1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199ABBA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C0"
FT                   /transl_table=1
FT                   /translation="MTVIPDTEDKVINAELSYAGLEITGLTEESIAAKRAATELRDALA
FT                   VSYSFKNICKIQYLGAFEKLTKLKLDNNFITRIENLDHLVHLQQLNLSFNRITKIEGLN
FT                   ALTKLKDLSLFNNEIQKVEGLDAQVATLEHLSLGNNKLDSLIDAFAGLRPFHGLRILTL
FT                   QGNPIHDDPDYKLYALGRLPWLKYLDHRRTKQDELEKARDLYVDEILEIEDRENDQRLK
FT                   AEDAAKAEAKRVKIEASNLTGVPDLFERMLAADPEYEKLRYIPNKEAPELCNGLELFKD
FT                   KYQQRCEAFTELMDDQLERKKNERAEWQAVVDGELRQKDVEAREWVTEFETLKKHALRD
FT                   CDKSEAGVTPELESRLRDLLDKSEELYNKLMAQEQWTAVVIDDLVTNYDLQLGEIVDES
FT                   KKHVMDYFEYARGLEETYFDGFNEAVGSVLMRLGQDELDEADEEVKDFLGDKDRFMNSC
FT                   QNHHDSHVNTIDTAEETMSKEEKRRHEAEVEELREWQATRNRGRVAEMLAMRKRYRGEI
FT                   EEYLEGE"
     atgacggtga taccggacac ggaagataag gtgataaacg cggagctctc ctacgcgggc        60
     ctcgagataa cgggcctgac ggaggagtcc atcgctgcga agcgcgccgc gaccgagctc       120
     cgcgatgccc tcgctgtctc atatagcttc aagaacatct gtaagatcca gtacctgggc       180
     gcgttcgaga agctcaccaa gctcaagctg gacaacaact tcatcaccag gatcgagaat       240
     ttggaccacc tcgtgcacct ccagcagctc aacctcagct tcaacaggat cacgaagatc       300
     gagggtctga acgcgctcac caagctcaag gatctctccc tgttcaataa cgagatccag       360
     aaggttgagg gccttgacgc gcaggtcgcc acgctggagc atctcagcct cgggaataac       420
     aagctcgact ccttgattga cgctttcgcg ggtcttcgac ccttccacgg cctgcggatc       480
     ctcaccctgc aggggaaccc catacacgat gacccagact ataagctata cgcgctcggg       540
     aggctgccgt ggctcaagta cctcgaccac aggcgcacaa agcaggacga gttggagaag       600
     gcgagggacc tctacgtcga cgagattttg gagattgagg atcgggagaa cgaccagagg       660
     ctgaaggcgg aagacgccgc gaaggcggag gctaagcggg tgaagatcga ggcgtccaat       720
     ctgaccggcg tacccgatct gttcgagcgg atgctcgcag cggacccgga gtacgagaag       780
     ctccgttaca tccccaacaa ggaggcgccc gagctgtgca acgggctgga gctgttcaag       840
     gataagtacc agcagcggtg cgaggcgttc acggagctga tggacgatca gctcgagcga       900
     aagaagaacg agagggcgga gtggcaggcc gtggtagacg gggagctgcg acagaaggac       960
     gtagaggcgc gcgagtgggt cacggagttt gagactctca agaaacacgc gctccgcgat      1020
     tgcgataaat cggaagccgg cgtcaccccg gagctggaat cgcggcttcg cgacttgctc      1080
     gacaagtccg aggaacttta caacaagctc atggcgcagg agcagtggac cgcagtcgtc      1140
     atcgacgacc tggtgacaaa ctacgatttg caactcggcg agatcgtgga cgagagtaag      1200
     aagcacgtga tggactactt tgagtacgcg cggggcctgg aggagaccta ctttgacggg      1260
     ttcaacgaag ccgtcgggtc cgtgctcatg agactcgggc aggacgagct ggacgaagcc      1320
     gacgaggagg ttaaggactt cctcggggac aaagacaggt tcatgaactc gtgtcagaac      1380
     catcacgatt cgcacgtcaa caccatcgac accgcggagg agacaatgtc aaaggaggag      1440
     aagaggaggc acgaggcgga ggtggaggaa ctgagggaat ggcaggcgac caggaatagg      1500
     gggcgcgtcg cggagatgct ggccatgaga aagcggtaca gaggtgagat cgaggagtac      1560
     ctcgaggggg agtga                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page