(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE244

MICSR_1.PE244        Location/Qualifiers
FT   CDS_pept        complement(492895..494346)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636584"
FT                   /orf_name="MICPUN_56817"
FT                   /product="Predicted protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62146.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI000199ABBB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C1"
FT                   /transl_table=1
FT                   /translation="MGSSVNAEKKAKKEKKDKKDTKDKKEAKSDAGKKDASKKTAAAAA
FT                   QPMGKAAKKKALLDWFHGALKGDTDGARADFLKARDYVAVANVIRKHARDPKLKGAHAD
FT                   AIKLLDNKGHFLNIVDVVVKDGAADASTHWDKIKAHHRAKFEKAGGKDGVAEKKRAARE
FT                   AKEAFKVLQKERAEREAKQKELAADRKEYRQKMDEVRLKGACLDWCNLGKCKFGDECQF
FT                   KHPDELKGTLVALANKIKAKDVGGKKGKEREETERRKKRKAAKKEKERDGEGGGDSDSD
FT                   ADDGGGGDSESEDSFDRAAQAEDEYDSEDFDSDLDVDVDKSTGAKTKRKKRKDKVLSVL
FT                   PGDDGSDSDGDDEDLPRMVRLRKQKQREEAEWAKAERAAKKAKQAKILEKVKAARAAKG
FT                   LEMPKRQGSRDRSGGRGGGGRGGGGGRGGRGGRGGRGGRGGRGGRGEKRSFDGQASGEK
FT                   RKKKPRHADGRHAKHAAAHAARTAA"
     atgggctcct cggtcaacgc cgagaagaag gccaagaagg agaagaaaga taagaaagac        60
     acaaaggata agaaggaggc caagtccgat gccggaaaga aggacgcatc gaagaagacc       120
     gccgccgccg ccgcccaacc gatgggcaag gctgccaaga agaaggcctt gctcgattgg       180
     ttccacgggg ctttgaaggg ggacaccgac ggcgcgcgcg ctgacttcct caaagcacgc       240
     gattacgtcg ccgtcgccaa cgtcatccgc aagcacgcgc gggacccgaa gctgaaaggc       300
     gcccacgccg acgccatcaa gctgctggac aacaagggcc acttcctcaa catcgtcgac       360
     gtcgtcgtta aggacggcgc ggcggacgcg tccacgcact gggacaagat caaggcgcac       420
     cacagggcaa agttcgaaaa ggctgggggc aaggacggcg tcgcggagaa gaagcgcgcg       480
     gcccgagagg cgaaggaggc gttcaaggtt ttgcagaagg agcgcgccga gcgcgaggct       540
     aagcagaagg aactcgccgc cgaccgcaag gagtatcggc agaagatgga cgaggtgcgc       600
     ctgaagggcg cctgtctcga ctggtgcaac ttgggcaagt gcaagttcgg cgatgagtgc       660
     cagttcaagc acccggacga gctcaagggg acgctcgtgg cgctggcaaa caagatcaag       720
     gccaaggacg tgggcggcaa gaagggaaag gagcgcgagg aaaccgagcg gcgcaagaag       780
     cgaaaggccg ctaagaagga gaaggagcgc gacggcgaag gaggcggcga cagcgacagc       840
     gacgcggacg acggcggcgg gggagacagc gaaagcgagg acagctttga tcgcgccgct       900
     caggccgagg acgagtacga ctctgaggac tttgacagcg acctcgacgt cgacgtcgac       960
     aagtccaccg gcgccaagac caagcgaaag aagcgaaagg ataaggtcct gagcgtcctg      1020
     cccggggacg acggctctga cagcgacgga gacgacgagg acctgccgcg gatggttcga      1080
     cttcggaagc agaagcagag ggaggaggcc gagtgggcca aggctgagcg cgccgcgaag      1140
     aaggccaagc aggcgaagat actggagaag gtaaaggctg cgagggcggc gaaaggtctg      1200
     gagatgccaa aacgccaggg gtcaagggac aggagcggcg gacggggcgg cggcggaaga      1260
     ggaggcgggg gcggaagggg cggaaggggc ggaaggggcg ggagaggcgg aaggggcggg      1320
     agaggcggaa ggggggagaa gcgcagcttc gacggccagg catccgggga gaagaggaag      1380
     aagaagccgc gtcacgcgga cgggcgacac gccaagcacg ccgccgcgca cgccgcccgc      1440
     accgccgcct ga                                                          1452
//

If you have problems or comments...

PBIL Back to PBIL home page