(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE245

MICSR_1.PE245        Location/Qualifiers
FT   CDS_pept        complement(494473..495027)
FT                   /codon_start=1
FT                   /gene_family="HOG000264638" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636585"
FT                   /orf_name="MICPUN_99389"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62147.1"
FT                   /db_xref="HOGENOM:HBG609069"
FT                   /db_xref="InterPro:IPR010754"
FT                   /db_xref="UniParc:UPI000199ABBC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C2"
FT                   /transl_table=1
FT                   /translation="MAIYVKAFSLVLKTVSKPLAKQVKEMAKSHPFLRELSISMALKAD
FT                   SLYQTIMSPTPLNEPIISSGGRRMKIPKKPPVMTEDQALQAAGDFLAEATVFGIAGGLV
FT                   WWEQSKSAEKDEKKAAAAKEEREQLTTMIALQQRTLQDVTEVLKEFEQHRRETSAALEE
FT                   MQRRARERDSRRWWGWAAAVS"
     atggccatct acgtcaaggc gttctcgctc gtgctcaaga cggtgtccaa gcccctcgcg        60
     aagcaggtga aggagatggc gaagtcccac ccgttcctac gagagctatc catcagcatg       120
     gcgctcaagg ctgacagcct gtaccagacc atcatgtccc cgacgcctct gaacgagcca       180
     ataatcagct cgggggggcg aaggatgaag atacccaaga agccgcccgt gatgacggag       240
     gatcaggcgc tgcaggccgc gggggatttc ctggccgagg cgacggtgtt cggcatcgcg       300
     ggtgggctgg tgtggtggga gcagagcaag agcgcggaga aggacgagaa gaaggcggcg       360
     gcggccaagg aagagaggga gcagctcacg acgatgattg cgctgcagca gcggacgctg       420
     caggacgtga ccgaggtgct gaaggagttc gagcagcaca gacgggaaac cagcgcggcg       480
     ctggaagaga tgcagagacg cgcgcgggag agggactcga ggcggtggtg ggggtgggcc       540
     gccgcagtca gctag                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page