(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE246

MICSR_1.PE246        Location/Qualifiers
FT   CDS_pept        join(495435..495616,495760..499306)
FT                   /codon_start=1
FT                   /gene_family="HOG000166737" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636586"
FT                   /orf_name="MICPUN_56819"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO61711.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG330902"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015016"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199ABBD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C3"
FT                   /transl_table=1
FT                   /translation="MVSTRRSPNPPPDEEEAAILALQEERKQAEAAAKEQKIAAENAKA
FT                   AAKAAAAAAAKDEGPRKAKLTSFTAPKEVLDDLPVADFQDEEGVEQFGASKRIVDRESD
FT                   YSKRRLNRSVAGDASTYAERVKEAQLEREKDNTMKQIAQKRREEAERAAADARLAAARG
FT                   DDAGGDERDALPSASAEPAAKRAKPAEVEWEDMPVAADAPAQPKPARRNRWDATPVAGD
FT                   VGGTGSWDATPKIDAGAGGGVGPTPKRTRSRWDETPLIRAGAAGDPNATPLGAGAFDGG
FT                   ATPGPGQLAGMVTPDIHGLAAQHMAAANVPMTPEQYNAMRWEREVEARNAPLTDEDLDL
FT                   MLPSEGYKILPVPDSYVPIRTPARKLMATPTPYGGATPGFYAMPDEDRGQAFDVPDTPA
FT                   DLPTMKPEDYQYFAPLLKETEEEELSLEEQKERKIMKLLLKVKNGTPPQRKSALRQLTD
FT                   KAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEP
FT                   LLIDEDYYARVEGREIISNLSKAAGLATMIAAMRPDIDNIDEYVRNTTARAFAVVAQAL
FT                   GIPALLPFLKAVCQSKKSWQARHTGIKISQQIAILLGCAVLPHLKSLVEIIEHGLQDEN
FT                   QKVRTITALSVAALAESAAPYGIESFDSVLKPLWKGIRAHRGKVLAAFLKAIGFIIPLM
FT                   DAMYANYYTREVMVILIREFASADEEMKKITLKVVKQCVGTDGVEPEYIRTEVMPEFFK
FT                   NFWVRRMALDRRNYNQLVETTLEIALKVGASEIIGRVVEDLKDESEPYRRMVMETITKV
FT                   IEKLGTADVDARLEELLIDGILYAFQEQTADDGDVMLTGFGTVVSSLGKRSKPYLPQIC
FT                   GTIKWRLNNKSADVRQQAADLISKIAKVMKICEEEQLMGHLGVVLYEYLGEEYPEVLGS
FT                   ILGALKGIVNVTGMSRMTPPVKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEFVP
FT                   AREWMRICFELLEMLKATKKAIRRATVNTFGYIAKAIGPQDVLATLLNNLKVQERQNRV
FT                   CTTVAIAIVAETCSPFTVLPALMNEYRVPELNIQNGVLKSLAFLFEYIGEMGKDYIYAV
FT                   TPLLEDALMDRDLVHRQTAAVTVKHLALGCAGLGCEDALVHLLNYVWPNVFETSPHLIN
FT                   AVMEAIEGARISLGPGFVLGYLLQGLFHPARKVREIYWKIYNTLYIGAQDALVAQYPAL
FT                   EDEGERQYRRHELDVFI"
     atggtgagca ccaggcgctc cccgaacccg cctcccgatg aggaggaggc ggccatcttg        60
     gctcttcagg aggagcgcaa gcaggccgag gctgcggcga aggagcagaa gatcgccgcg       120
     gaaaatgcca aggcggcggc caaggcggcg gccgccgcgg cagcgaagga tgaggggccg       180
     agaaaggcga agctcacgtc gttcaccgcg ccgaaggagg tcctcgacga cctccccgtg       240
     gcggacttcc aggacgaaga gggcgtcgag cagttcggcg cgtccaagcg gatcgtcgat       300
     cgcgagtcgg actacagcaa gcgaaggctc aaccgatccg tcgccggaga cgccagcacc       360
     tacgcggagc gcgtcaagga ggcgcagctg gagcgcgaga aggacaacac gatgaaacag       420
     atcgcgcaga agaggcggga ggaggcggag agggcggccg cggacgcgcg gctcgcggcg       480
     gcgcggggcg acgacgccgg cggcgatgaa agagacgccc tcccatccgc gtcggccgag       540
     cccgccgcca aacgggccaa gccggcggag gtggagtggg aggacatgcc ggtggcggcg       600
     gacgcccccg cccagcccaa acccgcgcgg cgcaaccgtt gggacgcgac gcccgtcgcg       660
     ggtgacgtcg gcggaacggg atcgtgggat gcgacgccga agattgacgc gggggcgggc       720
     ggcggggtgg ggccgacgcc caagcgcacg cgctcgcggt gggacgagac cccgctgatc       780
     cgcgcggggg cggcgggaga tcccaacgcc accccgctgg gcgccggtgc gttcgacggc       840
     ggcgccacgc cgggccccgg gcagctcgcc gggatggtca ccccggacat tcatggactc       900
     gccgcgcagc acatggcggc ggcgaacgtg ccgatgacgc cggagcagta caacgcgatg       960
     cgatgggagc gcgaggtgga ggctaggaac gcgccgctca cggacgagga cctggacctg      1020
     atgcttccct cggaaggcta caagattttg ccagtgcccg attcctacgt gcccatccgg      1080
     accccggcga ggaaactgat ggcgacgccc acgccctacg gtggcgccac gcccgggttc      1140
     tacgcgatgc cggacgaaga caggggccag gcgttcgacg tgcccgacac acccgcggat      1200
     ctgcccacga tgaaacccga ggattaccag tacttcgcgc cgttgctcaa agagacggag      1260
     gaggaggagc tgtcgctcga ggagcagaag gagcgcaaaa tcatgaaact cctgttgaag      1320
     gtgaagaacg gtacgccgcc gcaacgcaag agcgcgctgc gtcagctgac ggacaaggcg      1380
     cgggagtttg gcgcgggccc gctgtttaac cagatcctgc cgctgctcat gtcgccgacg      1440
     ctcgaggacc aggagcgcca cctcctggtc aaggtgattg accgcatcct gtacaagctc      1500
     gacgacctcg tccgacctta cgtacacaag atcctcgtgg tgatcgagcc gctcctgatc      1560
     gacgaggatt actacgcgcg cgtcgagggg agggagatta tcagcaacct gtccaaagcc      1620
     gcggggctgg cgacgatgat tgccgcgatg cgaccggata ttgacaacat cgacgagtac      1680
     gttcgcaaca cgacggcgag agccttcgcg gtggtggctc aagcgctggg tatccccgcg      1740
     ctgctgccct tcctcaaggc tgtttgccag tcgaagaagt cgtggcaggc gaggcacacg      1800
     ggcatcaaga tctctcagca aatcgccatc ctcctcggat gcgccgtgct cccccacctc      1860
     aagtccctcg tcgagatcat cgagcacggg ctccaggacg agaaccagaa ggttcgaacg      1920
     atcaccgcgc tctccgtcgc ggcgctcgcc gagtccgccg ccccttacgg catcgagtcg      1980
     ttcgattccg tgctcaagcc gctgtggaag ggtatccgcg cgcaccgcgg caaggtgctc      2040
     gctgcgtttc tcaaagccat cggcttcatc atccccctca tggacgcgat gtacgcaaac      2100
     tactacacca gggaggtgat ggtgatcttg atccgcgagt ttgcgtccgc tgacgaggaa      2160
     atgaagaaga tcacgctgaa ggtggtgaag cagtgcgtcg gaaccgacgg cgtggagccg      2220
     gagtacattc gcaccgaggt gatgcccgag tttttcaaaa acttttgggt ccggcgcatg      2280
     gccctggatc gacgaaacta caaccagctg gtggagacca cgctggagat cgcgctcaag      2340
     gttggggcga gcgagatcat cggtcgggtc gtggaggacc tcaaggacga gtccgagccg      2400
     tacaggcgca tggtgatgga gacgatcacg aaggtcatcg agaagttggg caccgccgac      2460
     gtggacgcga ggctggagga gcttctcatc gacgggatcc tgtacgcgtt ccaggagcag      2520
     acggcggacg acggtgacgt catgctcacg ggattcggga ccgtggtgtc gtcgctgggc      2580
     aagaggtcca agccgtacct gccccaaatt tgcggcacca tcaaatggcg gctcaacaac      2640
     aagagcgcgg acgtgcggca gcaggcggcg gatctcatca gcaagatcgc caaggttatg      2700
     aagatctgcg aggaggagca gctcatgggc cacctgggcg tggtactcta cgagtacttg      2760
     ggcgaggagt acccggaggt tttgggttcg atcctcggag ccctgaaggg gatcgtgaac      2820
     gtcacgggaa tgtcgcggat gacgccgccg gtgaaggatc tgctgccgcg tctcaccccg      2880
     attctcaaga acaggcacga gaaggttcag gagaactgca tcgacctcgt gggtcgcatc      2940
     gcggaccggg gcgcggagtt cgtccccgcg cgcgagtgga tgcgaatctg cttcgagctc      3000
     ctcgagatgc tcaaggcaac aaagaaggca atccgccgag ccacggtgaa cacctttgga      3060
     tacatcgcga aggccatcgg cccccaggac gtcctcgcca cccttctgaa caacctaaag      3120
     gttcaggagc gccagaaccg cgtgtgtacc acggtcgcga tcgccatcgt cgccgagacg      3180
     tgctccccat tcacggtgct cccggcgctt atgaatgagt accgcgtgcc ggagctcaac      3240
     atccagaacg gcgtcctcaa gtcgctcgcg tttctcttcg agtacatcgg cgagatgggc      3300
     aaggattaca tctacgcggt gacgccgttg ctggaggacg cgctcatgga ccgggacctc      3360
     gtgcacaggc agactgcggc ggtgacggtg aagcacctgg cgctcggatg cgcgggtctc      3420
     ggatgcgagg acgcgctggt gcacctcctg aactacgtgt ggccgaacgt cttcgagacg      3480
     tcgccgcatc tcatcaacgc ggtgatggag gcgatcgagg gcgcgaggat aagcctcggt      3540
     ccggggtttg tcttggggta cctgctccag ggtttgttcc acccggcgcg gaaggtgcgg      3600
     gagatttact ggaagatata caacacgctg tacatcgggg cgcaggatgc gctggtggcg      3660
     cagtaccccg cgcttgagga tgagggcgag cgtcagtatc gcaggcacga gctcgacgtc      3720
     ttcatctga                                                              3729
//

If you have problems or comments...

PBIL Back to PBIL home page