(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE247

MICSR_1.PE247        Location/Qualifiers
FT   CDS_pept        complement(<499470..500141)
FT                   /codon_start=1
FT                   /gene_family="HOG000171916" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636587"
FT                   /orf_name="MICPUN_72415"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62148.1"
FT                   /db_xref="HOGENOM:HBG627010"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199ABBE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C4"
FT                   /transl_table=1
FT                   /translation="MAEGGKTSVSNYDLDGNSFRNTMHSLNYGNVMEAAARNYMKEVKA
FT                   EEAAAANVGPIQYDLEDLEDDPELHQLHKERIQQMKEEQEKRREMQRKGHGEYRDIDEG
FT                   EFLPEVTGSFQVCVHFYHQEFERCRIVDKHMAILAKKYFDTKFIKVHAPDCPFFVTKLN
FT                   VKVLPCIVFFRNGVAYDRIVGFEELGAKDDFPTSRLENMLLTAGIIAVPEKGEDDSEDE
FT                   EE"
     atggcggaag gcggcaagac gagcgtgtcc aactatgatc tcgacggcaa cagcttcagg        60
     aacaccatgc actcgctgaa ctacggcaac gtcatggagg ccgccgcgag gaactacatg       120
     aaggaagtca aggcggagga ggctgccgcg gcgaacgtcg gtccgattca gtacgacctg       180
     gaggacctcg aggacgaccc agagctccac cagctgcaca aggagcggat acaacagatg       240
     aaggaggagc aggagaagag acgggagatg cagcgcaagg gccacggcga gtatcgcgac       300
     atcgacgagg gcgagttcct tcccgaggtg accggatcgt tccaggtgtg cgtccatttc       360
     taccaccagg agttcgagcg gtgccgcata gtcgacaaac acatggcgat cctcgcgaag       420
     aagtacttcg acaccaagtt catcaaggtg cacgcgccgg actgcccctt cttcgtcacc       480
     aagctcaacg tgaaggtgct cccgtgcatc gtctttttcc gcaacggcgt cgcgtacgat       540
     cgcatcgtcg ggttcgagga gctcggcgcg aaggacgact tcccgacgtc caggctggag       600
     aacatgctgt tgacggcggg catcatcgcc gtgccggaga agggggagga cgacagcgag       660
     gacgaggagg aa                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page