(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE249

MICSR_1.PE249        Location/Qualifiers
FT   CDS_pept        complement(502473..503750)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636589"
FT                   /orf_name="MICPUN_56822"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62149.1"
FT                   /db_xref="UniParc:UPI000199AC32"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C6"
FT                   /transl_table=1
FT                   /translation="MSTISTAPARWCRSVRASPGRSLRHAANCFALGSAAFVLRFTALA
FT                   DADATTAMAATPDHLSTAALARDVVDLASASLYTLGSTLWLHQTVLRERLRGSTQSPAA
FT                   VADSMDEQSATRWSQPPTWNEIAELVSGNPVVCSVVLFLCGCALDDALSLSDVIAEEVA
FT                   TRARGGLSNGEIWPPSLDPRQPAQPARISFELVLPFAPGVVGAVAFGVGGAARLVRLVR
FT                   GDGDSFDTRDEANMWLPCERDDECASMVPPPEVTERLDARIANVARFAQWPLNLLASFA
FT                   FIDGAWLAEFGAWSKLAGAQPASGNVLASVGGDVINVASSLSESAARLASENYVVGNSL
FT                   ADLGSIRDDLFGGRNGSPGDATAADGLATGAHRALSSSDAAHALGGGLFLVSSVAWIVE
FT                   LRARRRLRCARRGDDGDGHGDGDGDA"
     atgtccacga tatccacggc cccggcgcgg tggtgtcgct ccgtccgagc tagccccggc        60
     cggtcccttc gccacgccgc caactgcttc gccctcggca gcgcggcgtt cgtgctgaga       120
     ttcacagcct tggccgacgc cgacgcgaca accgcgatgg ccgctacgcc ggatcatttg       180
     tcgaccgccg cgctcgctcg cgacgtcgtc gacctcgcgt ccgcgtcgct gtacaccctc       240
     ggttccaccc tgtggctcca ccagaccgtg ctgcgggaac gcctgcgcgg gtcgacccaa       300
     agccccgccg ccgtcgccga cagcatggac gagcagtcgg ccacccggtg gtcgcagccg       360
     ccgacgtgga acgagatcgc ggagctcgtg tccggtaacc cggtggtgtg ctcggtggtg       420
     ctgttcctgt gcggatgcgc gctcgacgac gccctctccc tctccgacgt catcgccgag       480
     gaggtggcga cgagggctcg cggcgggctc tcgaatggcg aaatttggcc gccgtcgctc       540
     gacccgcgtc aacccgctca acccgcgaga atctcgttcg agctcgtgct ccccttcgct       600
     cccggcgtcg tcggcgccgt cgctttcggc gtcggcggcg ccgcgcggct cgttcgactc       660
     gttcgaggcg atggcgactc tttcgacacg cgcgacgagg ccaacatgtg gctcccttgc       720
     gaacgcgacg acgaatgcgc gtcgatggtc ccgccccccg aggtcaccga gcgattggac       780
     gctcgaatag cgaacgtcgc gaggttcgcg cagtggccgc tgaacctgct cgcgtcgttc       840
     gccttcatcg acggcgcgtg gctggcggag ttcggcgctt ggtccaagct ggcgggcgcg       900
     cagccggcgt ccggcaacgt gctggcgtcc gtcggtggcg acgtcatcaa cgtggcgagc       960
     tcgttgtcgg agtccgccgc gcggctcgcg tcggaaaatt acgtcgtcgg taactctttg      1020
     gcggacctcg gatcgattcg agacgacctg ttcgggggca gaaatggctc ccccggtgac      1080
     gctaccgccg cggatggcct ggcgacgggt gcgcacagag cgctgtcaag ctcggacgcg      1140
     gcgcacgcgc tcggtggggg gctgttcttg gtgtcctccg tcgcgtggat cgtggagctg      1200
     cgcgcgcggc gtcggctgag atgcgcgcgg cggggcgacg acggcgacgg ccacggcgac      1260
     ggcgacggcg acgcgtga                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page