(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE250

MICSR_1.PE250        Location/Qualifiers
FT   CDS_pept        504300..504959
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636590"
FT                   /orf_name="MICPUN_56823"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61713.1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="UniParc:UPI000199AC33"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C7"
FT                   /transl_table=1
FT                   /translation="MRYFMRYLLACSAGESSVGEGRAAERAESTRKTPPTMMTTRVLLA
FT                   PTTRSSIAVGKGKAFANDSTSRGATRVVTTALPSTASRAKITISGGALALALAFTPPAL
FT                   AALDPYGGVGLEIYVGPDRLPAIVEFLPTKTTGPAHDAGLRLNDKILEVNGVAATELGG
FT                   LQGVAKALRGEAGTDVDVTVGRGRGRAPLAVEKVRMKREEIAPNPRSCFVASCARV"
     atgaggtact ttatgaggta ccttttggcg tgcagcgctg gtgaaagttc cgtcggggaa        60
     gggcgggcgg ccgagcgggc agagtcgacg cgcaaaaccc cgccgaccat gatgacgacg       120
     cgagtgttat tagccccaac cactaggtcc agcatcgccg tcggcaaagg gaaggcattc       180
     gcgaatgact ccacttcgcg cggggcgacg cgcgtcgtca caacggccct accttcgacc       240
     gcctcgcgag caaaaataac aatcagcggc ggagccctcg ctctcgccct cgcgttcacg       300
     ccgcccgcgc tcgcggcgct ggacccgtac ggaggcgtcg gcctggagat ctacgtcggg       360
     cccgacaggc tccccgcgat cgtcgagttc ctgcccacga agaccacggg cccggcgcac       420
     gacgcgggat tgcggctcaa cgacaagatc ctagaggtga acggcgtcgc ggcgacggag       480
     ctcggaggtc tgcaaggggt ggcgaaagct ctgaggggcg aggcgggcac ggacgtggac       540
     gtgaccgtgg gtcggggacg gggaagggcg ccgctcgcgg tggagaaggt gaggatgaaa       600
     cgcgaggaaa tcgcgccaaa cccgcgttcg tgtttcgtcg caagctgcgc gcgcgtgtga       660
//

If you have problems or comments...

PBIL Back to PBIL home page