(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE251

MICSR_1.PE251        Location/Qualifiers
FT   CDS_pept        complement(505082..505972)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636591"
FT                   /orf_name="MICPUN_107894"
FT                   /product="Predicted protein"
FT                   /function="thiopurine S-methyltransferase activity "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO62150.1"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0008119"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="UniParc:UPI000199AC34"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C8"
FT                   /transl_table=1
FT                   /translation="MKHKNSLLGEGVTSPPELSKRVFVPLCGKAVDMLWLASCGHRVYG
FT                   VDLSGVAARDFFDEAGLPRTTTPADAMVAERWSAGVKRVHTSGNIAIVEGDLFSIRPDP
FT                   DPRPDEDDARSYGWFGVMPRVDSGGSIIARSSSNIANEDGPDTSSALDARVGAQGSISF
FT                   REEALRFASGGGPAMDAVWDRGALVAVEPSLRDRYASALVARLAPGGRMLVVSLSYDPN
FT                   AGCAGPPHNVPHEELVRLYESRGCEVTLLGSEEVIESAPPRMREKISSMTESAYLVRKP
FT                   HRRGKGGFHLPRPRL"
     atgaagcata aaaactcgct cctgggcgag ggggtcacgt ccccgccgga gctctccaag        60
     cgcgtgttcg tcccgctgtg cggcaaggcg gtggacatgc tgtggctcgc gtcgtgcggg       120
     cacagggtgt acggcgtgga cctcagcggc gtagcggcga gggacttttt cgatgaagcc       180
     ggtttacctc ggacgacgac gccggcggat gcgatggttg ccgaacgatg gagcgccggt       240
     gttaaaaggg tccacaccag cggcaacatc gccatcgtgg agggggatct cttctcgatc       300
     cgtccggacc cggacccgag gcccgacgag gacgacgcaa ggtcttacgg gtggttcggc       360
     gtgatgcccc gcgtcgactc gggtggttcg atcatcgcga ggtcgtcgtc gaacatcgcc       420
     aacgaggacg gacccgatac gtcgtcggcc ctggacgcca gggtcggggc gcagggcagc       480
     atatcgttcc gcgaggaggc gctgcggttc gcgtcaggcg gcggacccgc gatggacgcg       540
     gtgtgggatc gcggcgccct cgtcgccgtc gagccgtcgc ttcgcgatcg gtacgcgagc       600
     gccctggtgg cgcgattggc ccccgggggt cgaatgctcg tcgtgtccct gtcctacgac       660
     ccgaacgcgg ggtgcgccgg gccgccgcac aacgtcccgc acgaggagct cgtgcggctg       720
     tacgagtcgc gagggtgcga ggtgacgctg ctggggagcg aggaggtcat cgagtcggcg       780
     ccgccgcgta tgagggagaa gatatcgtcg atgacggaga gcgcgtacct ggttcggaag       840
     ccgcacaggc gcggcaaggg cgggtttcac ctgcctcggc ccaggctttg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page