(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE252

MICSR_1.PE252        Location/Qualifiers
FT   CDS_pept        507274..508422
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636592"
FT                   /orf_name="MICPUN_107895"
FT                   /product="Predicted protein"
FT                   /function="cobalt ion binding"
FT                   /function="oxidoreductase activity, acting on the CH-CH
FT                   group of donors, iron-sulfur protein as acceptor "
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="phytochromobilin biosynthetic process "
FT                   /protein_id="ACO61714.1"
FT                   /db_xref="GO:0010024"
FT                   /db_xref="GO:0016636"
FT                   /db_xref="GO:0050897"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR009249"
FT                   /db_xref="UniParc:UPI000199AC35"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C9"
FT                   /transl_table=1
FT                   /translation="MEFLFRTLDRSLGPLTPVHLPPELASASVPGKVRSETWVYTSPFV
FT                   RRARFTYVDGGEKTQIFNCVVYPRCVDDSTGEESHLGDAPLLGVDLLSLNGGKKILVGV
FT                   DLQPLSRSEAYLGRYVDALASLRDARFAELNLVEPSDRFYEDAQFFSPAMLFARPVPVD
FT                   VAVDCAVAAAKATGALQDLGTITAEDVCGVEWAEPNSGCGVPLVEAKTLDAVKAYAAKW
FT                   LELMDARNDDWAKAWDQGGRAGGGATSALGSRAGSFSQMLANNIKSAVGAKSEGGEDEP
FT                   AAEAADAAEGDPPAPPAEKTEEPKRAAEVRAGKYARVLTAAESAAAQDFHDMWQRSHDP
FT                   AIPMFAGWFGKEWAERLASEVLFPEDKAKEELKAWEAQQRGG"
     atggagtttc tgttccgaac gctcgatcgt tccttgggcc cgctgacccc ggttcacctg        60
     cccccggagc tcgccagcgc gtccgtcccg ggcaaggtgc gaagcgagac gtgggtctac       120
     acctccccgt tcgtccgccg cgcgaggttc acctacgtcg acggaggcga aaagacgcag       180
     atcttcaact gcgtcgtgta cccccgctgc gtggacgact cgacgggcga ggaaagtcac       240
     ctcggcgacg ccccgctgct cggcgtcgac ctcctcagcc tcaacggcgg caagaaaatc       300
     ctcgtgggcg tcgacctcca acccctctcg aggtccgagg cgtacctcgg ccgctacgtc       360
     gacgcgctcg cgtcgctcag ggacgcgagg ttcgcggagc tcaacctggt ggaacccagc       420
     gacagattct acgaggatgc gcagttcttc tccccggcga tgctcttcgc gaggccggtg       480
     cccgtggacg tcgccgtgga ctgcgcggtg gccgccgcga aggccacggg cgcgctgcag       540
     gacctcggca ccatcaccgc cgaggacgtg tgcggcgtgg agtgggccga gcccaacagc       600
     ggctgcggcg taccgctcgt cgaggccaag acgctcgacg ccgtgaaggc gtacgcggcc       660
     aagtggctgg agctgatgga cgcgcgtaac gacgactggg cgaaggcgtg ggaccagggc       720
     gggcgggcgg gcggcggggc gacgtcggcg ctcggctcga gggctggctc cttctcgcag       780
     atgctcgcca acaacatcaa gagtgccgtt ggcgcgaaat ccgaaggggg cgaagacgag       840
     cccgccgccg aagccgccga cgccgccgag ggcgacccgc ccgcgccgcc cgcggagaag       900
     accgaggagc cgaagagagc ggcggaagta cgggccggga agtacgcgcg ggtgctgacg       960
     gccgcggagt cggccgcggc gcaggatttc cacgacatgt ggcagcggtc gcacgatccg      1020
     gccatcccga tgtttgcggg ttggttcggg aaggagtggg cggagaggct ggcgtcggag      1080
     gtgctgtttc cggaggacaa ggcgaaggag gagctcaagg cgtgggaggc gcagcagagg      1140
     ggtggatga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page