(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE253

MICSR_1.PE253        Location/Qualifiers
FT   CDS_pept        join(508566..508691,508806..509182,509597..509891,
FT                   509946..510212)
FT                   /codon_start=1
FT                   /gene_family="HOG000030046" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636593"
FT                   /orf_name="MICPUN_80230"
FT                   /product="Predicted protein"
FT                   /biological_process="protein modification process "
FT                   /biological_process="protein transport"
FT                   /protein_id="ACO61715.1"
FT                   /db_xref="GO:0006464"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG560088"
FT                   /db_xref="InterPro:IPR008883"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017916"
FT                   /db_xref="UniParc:UPI000199AC36"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D0"
FT                   /transl_table=1
FT                   /translation="MPVSAQVQYYLNAKLTATGASALPYDERLKFAVRDQLLAVVERYP
FT                   SLSVRDDPFTHNDGRTVHLLRAEGTIPIYYMGVKYNIPLKMFLPEAFPHAQPICYVTPT
FT                   SNMIIKPGHSCVDGSGLVRSPYGDRWSYPRSNLTELAGLLSEAFGSEPPLFAKPAGYVP
FT                   PPPRTSPHVLAGGLSVAEGTFKARAITALSDRLRSELDVLRAQSGEEAERLLTLQAELA
FT                   RRREDIERSLREMRAERGAWEHRIGGMQAATVALEEWVSENEGKRKETEIADAAFRPED
FT                   PLSEQILEEMAKDLALEDAMDCLDEALSAKQIELEPYLELIRELSKEQFFARATTMVAR
FT                   KEQRERGVSQGVTF"
     atgccggtct cggcgcaggt gcagtactac ctcaacgcga agctcaccgc gacgggggcg        60
     agcgcgctgc cctacgatga gaggctcaag ttcgccgtgc gggaccagct gctggcggtc       120
     gtcgagagat acccgtcgct gagcgttcgc gatgacccgt tcacgcacaa cgacggccga       180
     accgtccacc tcctccgcgc cgagggcacc atcccgatct actacatggg cgtcaagtac       240
     aacatcccgc tcaagatgtt cctccccgag gccttcccgc acgcgcagcc catctgctac       300
     gtcacgccca cgagcaacat gatcatcaag cccgggcact cgtgcgtcga cgggagcggg       360
     ctggtccggt cgccctacgg cgacaggtgg agctacccga ggagcaacct gacggagttg       420
     gccgggctgc tctccgaggc gtttggctcg gagccgccgc tctttgccaa acccgccggg       480
     tacgtgccgc ccccgccgcg gaccagcccg cacgtgctgg ccgggggcct gtccgtcgcg       540
     gaggggacgt tcaaagctcg cgccatcacc gcgctgagcg ataggttgcg ctcggagctc       600
     gacgtgcttc gcgcgcagag cggcgaggag gcggagcggc tcctgacgct gcaggctgag       660
     ctggcgcgac ggagggagga catcgagcgc agccttcggg agatgcgagc ggagcgcggg       720
     gcatgggagc accgcatcgg gggcatgcag gcggcgacgg tggcgctgga ggagtgggtg       780
     tcggagaacg agggtaagcg gaaggagacg gaaatcgccg acgcggcttt ccggccggag       840
     gatccgctct cggagcagat tctcgaggag atggccaaag atttggctct ggaggacgcg       900
     atggattgcc ttgacgaggc gctcagcgcg aaacagattg agctggagcc gtatctcgag       960
     ctcatcaggg agctcagcaa ggagcagttc ttcgcgcgag cgacgacgat ggtggcgaga      1020
     aaggagcagc gcgagagagg cgtgtcccaa ggggtcacct tctga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page