(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE254

MICSR_1.PE254        Location/Qualifiers
FT   CDS_pept        complement(510294..512000)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636594"
FT                   /orf_name="MICPUN_56827"
FT                   /product="Predicted protein"
FT                   /function="calcium-dependent cysteine-type endopeptidase
FT                   activity"
FT                   /biological_process="proteolysis"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62151.1"
FT                   /db_xref="GO:0004198"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="HOGENOM:HBG559531"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="UniParc:UPI000199AC37"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D1"
FT                   /transl_table=1
FT                   /translation="MGCLSSKPADSPSSGRAHDYDPNLAPEAPKPVRPRPPAPATADVS
FT                   PIGDDEEFAPMPPQPAQPAGRKTLRSGDTPSAKNIHMESTTKMLQFMKHAESMDWPGPE
FT                   SRKWNYTSVETSGSYSFTKMGNKEQVNGTIASGLSTLHSNPGKYIGCMYQTDMVDWPED
FT                   QQQYTLIEREGTVGLKYKPGEAFTVEMANYQALPHVTEVDIDSIDDGVTMQMTSHGKLL
FT                   HGPRNVPLCPGRGMGVLDRPGIKIIQNVDPGDIHQGSVGDCWLLSAISALAEFDGAIFE
FT                   LFKKTPDMHQMPRAGPNRYHVTLYDLKTWQPVDVVVDERLASNPSNPGSLFGAKPSDDG
FT                   ELWACYLEKAFVAHCGGWDHIEGGVPPHAWAMLTGCKDQYTIEMEKSGKDKGKWNCWGN
FT                   YNKDRDFYNELANSSKEKQPPMWQQDWPEVGGGGEGAITGEELFRKVVAWDAADFIIGC
FT                   ASEGDNDTVKHDGIVDGHAYTVLQAFSNVAGSGVDLVQVRNPWGSGEFEKGMWTDINGL
FT                   ASGWQKYPKVKALLQPKVAEDGLFWMSKEEFYKYFKTVYLCAKSMRDFKVD"
     atgggatgcc tctcatcgaa acccgcggat tcaccttcgt ccggacgagc tcatgactac        60
     gacccgaatc tcgccccgga ggctcccaaa cccgtgaggc cccggccccc ggctcccgcg       120
     actgctgacg tcagccctat cggtgatgac gaggaattcg ctcccatgcc tccgcaacca       180
     gcgcaacccg cgggaaggaa gaccctccgc tccggcgaca ctcccagcgc gaaaaatatt       240
     cacatggagt ccaccaccaa gatgctgcag ttcatgaagc acgccgagtc catggactgg       300
     cccggcccgg aatcccgaaa gtggaactac acctccgtcg agaccagcgg atcctactcc       360
     ttcaccaaga tgggcaacaa ggaacaggtc aacgggacga tcgcgtcggg attgagcacc       420
     ctgcactcaa accccggcaa gtacatcggg tgcatgtacc agaccgacat ggtggactgg       480
     ccggaagatc agcagcagta caccctcatc gagcgcgagg gcaccgtggg tctcaaatac       540
     aaacccggcg aggcgttcac cgtcgagatg gcaaactacc aggcgttacc ccacgtcacc       600
     gaggtggaca tcgactccat cgacgacggc gtcacgatgc agatgaccag ccacggtaag       660
     ttgctccacg gtccgcgtaa cgtcccgctg tgtcccggcc gcggcatggg cgtgctggac       720
     cgcccgggga tcaagatcat ccagaacgtg gacccggggg atatccacca gggcagcgtg       780
     ggcgactgct ggctcctctc cgcgatatcc gcgctcgcgg agttcgacgg cgccatcttc       840
     gagctgttca agaagacgcc ggacatgcac cagatgccca gggcgggtcc gaaccgttac       900
     cacgtcaccc tctacgacct gaagacgtgg cagccggtgg acgtcgtcgt cgacgagagg       960
     ttggcgtcca accccagcaa cccggggtcg ctcttcggcg cgaagccgtc cgacgacggc      1020
     gagctgtggg cgtgttacct ggagaaggcg ttcgtcgcgc actgcggcgg ttgggaccac      1080
     atcgagggcg gcgtcccgcc gcacgcgtgg gcgatgctca cgggttgcaa ggaccagtac      1140
     acgattgaga tggagaagtc cggcaaggac aaggggaagt ggaactgctg gggcaactac      1200
     aacaaagatc gggacttcta caacgagctc gccaacagca gcaaggaaaa gcagccgccg      1260
     atgtggcagc aagactggcc ggaggttggc ggcgggggcg agggtgccat cacgggggag      1320
     gagctcttcc gtaaggtggt cgcttgggac gccgcagatt ttatcatcgg gtgcgcgtcc      1380
     gagggcgaca acgatacggt gaaacacgac ggaatcgtcg acggacacgc gtacacggtg      1440
     ctccaggcgt tctccaacgt cgccggcagc ggcgtggatc tggttcaggt caggaacccg      1500
     tggggctctg gtgagtttga gaaggggatg tggaccgaca tcaacggctt ggcgtctggc      1560
     tggcaaaagt acccgaaggt gaaagccctg ttgcagccga aggtggcgga ggacggactg      1620
     ttttggatga gcaaggagga gttttacaag tacttcaaga ccgtgtacct gtgcgcgaag      1680
     agcatgagag atttcaaggt tgactga                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page