(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE255

MICSR_1.PE255        Location/Qualifiers
FT   CDS_pept        <512146..>512826
FT                   /codon_start=1
FT                   /gene_family="HOG000184445" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636595"
FT                   /orf_name="MICPUN_71958"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61716.1"
FT                   /db_xref="HOGENOM:HBG316414"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI000199AC38"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D2"
FT                   /transl_table=1
FT                   /translation="HVVYRGPEGETTVWDDVQRRFGNKPPLPEKFVPRAYAPEEDRGLR
FT                   AAVERDGRAGGVAHVDAAGGTDALEAMEDEDAFADDGFLEEYRRKRLEEMKTAAAIPRF
FT                   GAVVEITRDSFMAHVTDPSSEHYVLVLLHRPNCPECELLNVAYRELARKHPFTKFTSIP
FT                   GKECIPGYPDRNMPTLLVYRNRDPVRTFMGLGHFGGRHMTPEGLELALNECGRVCAGAR
FT                   GGEDE"
     cacgtggtgt accgcggccc cgagggcgag accaccgtat gggacgacgt ccagcgtcgc        60
     ttcggcaaca agcccccgct gcccgagaag ttcgtccctc gcgcgtacgc ccccgaggag       120
     gatcgagggt tgagagcggc ggtcgagcgc gacgggcgcg cggggggcgt ggcccacgtc       180
     gacgccgccg gaggaacgga cgcgctcgag gcgatggagg acgaggacgc cttcgcggac       240
     gatgggttcc tggaggagta caggcgcaag cggctggagg agatgaagac ggcggcggcg       300
     atcccgaggt tcggcgctgt cgtcgagatc acgcgagact ccttcatggc ccacgtcacc       360
     gatccctcgt ccgagcacta cgtcctggtc ctgctccatc gccccaactg tccggagtgc       420
     gagctgctga acgtcgcgta ccgtgaactg gcgcggaagc acccgttcac caagttcacc       480
     agcataccgg gcaaggagtg catcccgggg taccccgatc gaaacatgcc cacgctgttg       540
     gtgtacagga accgcgaccc ggtgcgaacg ttcatgggcc tgggccactt cgggggcagg       600
     cacatgacgc cggaggggtt ggagctggcg ttgaacgagt gcgggagggt gtgcgcgggc       660
     gccaggggcg gcgaggacga a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page