(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE256

MICSR_1.PE256        Location/Qualifiers
FT   CDS_pept        complement(513056..514030)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636596"
FT                   /orf_name="MICPUN_56829"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62152.1"
FT                   /db_xref="InterPro:IPR019132"
FT                   /db_xref="UniParc:UPI000199AC39"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D3"
FT                   /transl_table=1
FT                   /translation="MGGKAKGKTSGTEGTAPTASNPAEDALNSVLDGLDTPEEKLAALS
FT                   AKFLELHKDLRRTSRRCDEAEGKVGMALVERDAARQELTKNAEVNDKLQALCRTLQGAN
FT                   KETSALLREREEAQLKLREDLEAKFDEGLGAVSKRIEESASVRDDLLKENDTLRDHLKK
FT                   LVARGDLQQETYAKAKDAFDLEKQLLEARLAEAVAFNDQLTAKLQQREEESKGYLEQLS
FT                   GYADKFDTFQGVISQSNETFTQFKTDIADLSKKLIESEAAKREMEAKTLKSDVAMIKLL
FT                   EEREQLTAQCVSLKAKKDKLEGLCRALQKQTISGDKENAKAAA"
     atgggcggca aggcgaaggg aaagacgagc ggcacggagg gcaccgcccc caccgcatcg        60
     aaccccgcgg aggatgcgct gaacagcgtc cttgacgggc ttgatacccc cgaggagaag       120
     ctcgcggcgc tctccgccaa gtttctcgag ctgcataaag atctgcggag gacgagcagg       180
     cgttgcgacg aggccgaggg caaggttggc atggcgctcg tcgagaggga cgccgcgcgg       240
     caggagctga cgaagaacgc tgaggtgaac gataagctcc aagccctctg ccgcacgctc       300
     cagggtgcga acaaggagac ctccgcgcta ctccgcgagc gcgaggaggc ccagctcaaa       360
     cttcgcgagg acctcgaggc caagttcgat gaggggctgg gcgcggtcag caagcgcatc       420
     gaggagtccg catccgtcag agacgacctc ctcaaggaga acgacaccct gagggaccac       480
     ctgaagaagc tcgtggcgcg gggcgatctc cagcaggaga cctacgcaaa ggctaaagat       540
     gcgttcgacc tggagaagca gctactggaa gccaggctcg ccgaagccgt ggcgtttaac       600
     gaccagctca cggctaaact gcaacagagg gaggaggaga gcaaggggta cctggagcag       660
     ctgtccggct acgcggacaa gttcgatacc ttccaggggg tcatctcgca gagcaacgag       720
     acgttcacgc agttcaagac ggacatcgcc gatctctcca agaagctcat cgagagcgag       780
     gcggcgaagc gggagatgga ggctaagacg ctgaaaagcg acgtggcgat gatcaagctg       840
     ctggaagaga gggagcagct cacggcgcag tgcgtgagcc tcaaggcgaa gaaggacaag       900
     ctcgaaggtc tctgtagagc cctccagaag caaacaatct cgggcgacaa ggaaaacgcc       960
     aaggctgcgg cgtga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page