(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE257

MICSR_1.PE257        Location/Qualifiers
FT   CDS_pept        join(514161..514658,515308..515494,515855..519729)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636597"
FT                   /orf_name="MICPUN_99395"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="ATP-dependent DNA helicase activity "
FT                   /function="DNA binding"
FT                   /biological_process="DNA repair"
FT                   /protein_id="ACO61717.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004003"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="UniParc:UPI000199AC3A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D4"
FT                   /transl_table=1
FT                   /translation="MFAVTQTASKALLAVPSKASKTRTGRVVVAAAVPHSAVESGKKAM
FT                   LTGILAATFAVGSVDPAQAATVFAGKYIDPNHPHCPREIDADGVISGVDPVPFAKGRGC
FT                   RGYKKKNEAAAVEAGKISLWSIKGVVSKDDATILIDFNQKDGSGESFTGKWNGVGIEFP
FT                   DGNASAPYFSMNAASGSSDVSASISRPFARSSMRCWYRFGGCHGKDGPAAVISLGLRAS
FT                   SKIPMALFGFAGADPKPEPKPEAPPAVANDAPGAVPARGGGAGAIGFSTASGTDRKPRG
FT                   GFRSASLAMAGASKAGVGSSLFTSASSMMVNPDTVDLTADDANEDESPGKRHKTSPEEG
FT                   NEEGKRKETRRYDPVEYREKQRIKREKDERTKKKRQECRQTSIFDAMAGANAPNLRGSA
FT                   DPIPKEVWQRILAHAPVSSLRDMRLVCKTLMNAVDDEGFLPFTKIAQQTRRMRTIDADR
FT                   VIAESAAGRRKPPAVSAAAGGGRVSIGDDRPARDDEDHAAGIIQRIARDKPFATPMSAS
FT                   ALAREVEIGVERAEARDGRTPVPGHVPGEGLAATVRELAGWKIVGSHGWALLAAAILVA
FT                   AEDYGTIALLLDAARRACARADREPDGDLNGGDTAGDNERRHHYTGDYCAREDLTEFIS
FT                   LLAIALTVPSRWTRGAVDAEDVVLREPSASRLAHLDAAAGYLELIPHREAAGDWGADRG
FT                   SFTSRLTHEQLSIVSADVKKDEVLLVRAFAGTGKTTTLLEYVKRRPGYQFAYITFNRSV
FT                   MEEASTKFPKLNVKCLNFHKMAYAKFGFLYRGEKFLRGTLRQYHVSKAIGVNDSRALFA
FT                   IRVLNEFLKSADLAVELKHAEAIRAEVSTKDWNKVYGKSNVKAKLGSQSPEENLVELVK
FT                   NLWDKMLNPEDSSFPMTDAGYLKRYQLACRREHNPVRLDVNFDILMLDEAQDAAPVMAD
FT                   IILSQKECGKILVGDPHQEIYSFMGAKNAMATVAATVDKSKIVERRLTRSFRFGYEIAD
FT                   VANTLLRLKGETTCLIGSRRDLPDPVWSSWSDQEEVSAVHCLPRPKDADGVTLTLQSYA
FT                   PGYAATLRTRLGDRPIREQGRQLVVLCRSNASVFDVASRILNLGIKDLKLGFIGGLEGQ
FT                   RLGQLMDIWRLAVQSDDELDAITDYFVSRFVKEYLKAKENGVKDPEPPLQALKSSAKLS
FT                   NDLEMQTKISIVEKHRGNLPELIEKLKKVDVGTNPSNLKCANYLLSTAHRAKGLEFDHV
FT                   LLWEDFLAVDHCSPVEWDSNGHATLFQIGNMFGDSEIVGADELNLVYVAATRAKQRLIV
FT                   SDALKHLITAPRCNFAATWYLRDRGTNLPLTGMTEVEAAEDWAANEVLAQRRGGPAHFA
FT                   TLRCATNTCDRCGDQSYMFQLPEGSFQADEVDNAPTLGMEVRYGRIRQGMADTDIGMAN
FT                   ADPHAVSTVPMIAPSESYAFRHNRRMCGRCVRTFAVSRRGAERYLDDDTAGAGVERTWV
FT                   DDTILENFVRHSNRVNNIDPIEGMSMMDIASVCAAERRARGEPWRGKDAAGQPRRMAD"
     atgttcgccg tgacccagac cgcatccaag gcgcttctag ccgtgccctc gaaggcctcg        60
     aagacgcgca ccggccgcgt cgtcgtcgcc gcggccgttc cccactccgc ggtcgagtcc       120
     ggcaagaagg cgatgctcac cggcattctc gcggcgacct tcgcagtggg ctcggtggat       180
     cccgcacaag ccgccaccgt gttcgcgggc aagtacatcg acccgaacca cccccactgc       240
     ccccgtgaga tcgacgccga cggcgtcatc tccggcgtgg acccggtgcc cttcgccaag       300
     ggaaggggat gccgcggcta caagaagaag aacgaggctg cggctgtcga ggctgggaag       360
     atctccctct ggtccatcaa gggcgtcgtc tccaaggatg acgccaccat cttgatcgac       420
     ttcaatcaga aggacggcag cggggagtcg ttcacgggaa agtggaacgg cgtggggatc       480
     gaattccccg acggaaacgc atccgcgccg tacttctcta tgaacgccgc gtcgggcagc       540
     tcggacgtat ccgcgtccat cagccggccg ttcgcgcgaa gctccatgag atgctggtac       600
     aggttcgggg gatgccacgg gaaggatgga cccgcggcgg tcatctcgct gggcttgcga       660
     gcatcatcga agatacccat ggcgcttttc ggcttcgcgg gcgcggatcc gaagcccgag       720
     ccaaaaccgg aggcaccgcc cgccgtggcg aacgatgctc ccggggcggt cccggcgcgt       780
     ggtggtggcg ccggcgcgat cggcttctcc acagcctcgg gcaccgatcg gaaaccgcga       840
     gggggattca ggtcggcgag tctggcgatg gccggtgcat ccaaagcggg cgttggctcc       900
     tcgctcttca ccagcgcgtc ctcgatgatg gttaatccgg acaccgtcga cctgacggcc       960
     gacgacgcga acgaagacga gtcgccgggg aagaggcata agacgtcgcc cgaggaagga      1020
     aacgaggaag gaaagaggaa ggaaacgagg aggtacgacc ccgtcgagta ccgggagaag      1080
     caaaggatca aacgagaaaa agacgaacgc accaagaaga agaggcagga gtgcaggcag      1140
     acgtccatct tcgacgcgat ggcgggagcg aacgcgccga atcttcgggg cagcgcggat      1200
     ccgatcccga aggaggtgtg gcagcgcatc ctggctcacg cgcccgtctc ctcgctcagg      1260
     gacatgaggc tggtgtgcaa gacgctgatg aacgcggtgg acgacgaggg gttcctgccc      1320
     ttcaccaaga tcgcgcagca gacgagacgg atgcggacga tcgacgcgga tcgcgtcatc      1380
     gccgaatccg ccgcggggag gaggaagccg ccagctgtgt cggcggcggc gggcggcggg      1440
     cgggtgagca tcggcgacga ccgtcccgcg cgcgacgatg aagaccacgc cgcgggtatc      1500
     attcaacgca tcgcgcgcga taaacccttc gccacgccca tgtccgcgtc ggcgctcgcg      1560
     cgggaggttg agattggcgt tgaaagggcc gaggcgcgcg acgggaggac gccggtgccg      1620
     ggtcacgttc ccggggaggg attggcggcg acggtgcgag aactcgcggg gtggaagatc      1680
     gtgggctcac acgggtgggc gctgctcgcg gcggcgatcc tcgtcgccgc ggaggattac      1740
     gggaccatcg cgctgttgct cgacgccgcg cgcagggcct gcgcccgcgc cgatcgcgag      1800
     cccgacgggg acctgaacgg gggcgacaca gctggcgaca acgaacgtcg tcatcactac      1860
     acgggcgatt actgcgcgag ggaggacctc acggagttta tctcgctgct cgccatcgcg      1920
     ctgacggtgc cgtcgcgttg gacccgcggc gcggtggacg ccgaggacgt cgtgctaagg      1980
     gagccgagcg cgtcgcggct ggcgcacctg gacgcggcgg cggggtacct ggagttgatc      2040
     ccgcatcgcg aggcggcggg agattggggc gcggaccgcg gttcgttcac ctcgcggctg      2100
     acccacgagc agctctcgat cgtgagcgcg gacgttaaga aggacgaggt gttgctcgtg      2160
     cgagcgttcg ccggcacggg caagacgacg accctgctgg agtacgtgaa gcgcagaccg      2220
     ggttaccagt tcgcctacat cacgttcaac cggtccgtca tggaggaggc ctcgaccaag      2280
     ttcccgaagc tcaacgtgaa gtgtctgaac tttcacaaga tggcgtacgc caagtttgga      2340
     ttcctgtacc ggggcgaaaa gtttctccga ggcacgctgc gacagtacca cgtctcgaag      2400
     gccatcgggg tcaacgacag cagggcgcta ttcgcgattc gcgtgctaaa tgagtttttg      2460
     aaatccgcag acttggccgt ggaattgaaa cacgcggagg ccatccgggc ggaagtgtcc      2520
     actaaggact ggaacaaggt gtacggcaaa tccaacgtga aagcgaaact cgggtcgcag      2580
     tcgcccgagg aaaacctggt ggaactcgtg aagaacctgt gggacaaaat gttaaatcca      2640
     gaggattcga gcttcccgat gactgacgcg gggtacctta agcggtacca gctggcgtgc      2700
     aggcgggaac ataaccccgt gcgattggac gttaacttcg atatactcat gctggacgag      2760
     gcgcaagacg ctgctcccgt gatggcggac ataatcctgt cccagaagga gtgcggcaag      2820
     atcctggttg gagatcctca ccaggagatt tactcgttca tgggcgcgaa gaacgccatg      2880
     gccaccgtcg cggcgactgt ggacaagtca aagattgttg agcgtcggtt gactcgatcg      2940
     tttaggtttg ggtacgagat cgcggacgtg gcgaacacgt tgctgaggct caaaggggag      3000
     accacgtgct tgatcgggtc cagacgggat ttgccggacc cagtctggtc ctcctggtcg      3060
     gatcaagaag aggtttcggc tgttcactgt cttccaaggc cgaaggatgc cgatggagtg      3120
     acgctgacgc tgcaatccta cgcacccggt tacgctgcaa ccctacgcac ccggctcggg      3180
     gatcggccta tcagggagca gggccgacaa ctggttgtgc tctgtcgcag caacgcgtcg      3240
     gtctttgacg tcgcgtccag aattctgaac ttgggcatca aagacctcaa gctgggattt      3300
     attggtggcc tagagggaca gagacttggt cagctgatgg acatatggcg gctggctgtt      3360
     caatccgatg atgagcttga tgctatcact gactacttcg tgagcaggtt cgtcaaggaa      3420
     tacctcaaag ccaaagaaaa cggggtgaag gaccccgagc ctcccttgca ggcactcaag      3480
     tcttctgcga agctttccaa cgatttggag atgcagacta aaatctccat cgtagaaaag      3540
     caccggggca atcttcctga actcatcgaa aagttgaaga aggttgacgt gggcacaaac      3600
     ccatccaatc tgaagtgcgc aaactacctg ctctccacag ctcacagggc caagggtctc      3660
     gaattcgacc acgtgctgct gtgggaggac ttcttggccg tcgatcattg cagtcccgtc      3720
     gaatgggata gcaacgggca cgcgacgctg ttccaaattg gcaatatgtt cggtgattct      3780
     gaaattgtcg gcgctgatga attgaacttg gtgtatgtcg cagcgacgcg tgccaagcag      3840
     cggctgattg tgagcgatgc actgaagcat ctcatcactg cccctcgatg caacttcgct      3900
     gcgacgtggt acttgcgaga tcgtggtact aatttgcccc tgactgggat gactgaagtg      3960
     gaagcagctg aggattgggc ggcgaacgag gttttggcac aacgacgggg cggacccgca      4020
     cattttgcga cgcttcgctg cgcaacaaac acctgcgata gatgcgggga tcagtcgtat      4080
     atgtttcaac tccccgaggg ctcgttccaa gccgacgaag tcgacaacgc gccaaccttg      4140
     ggcatggagg tgcgatatgg acgaatccgc caaggtatgg ccgacacaga cattggcatg      4200
     gccaacgcgg accctcacgc tgtcagtacc gttcccatga tcgcgccttc ggagagctac      4260
     gcgtttcggc ataacaggag gatgtgcggt cgctgcgtgc gaacgttcgc ggtgagcagg      4320
     cgcggcgccg aaagatatct ggacgacgac accgccggcg cgggtgtcga gagaacctgg      4380
     gtcgacgata ccatcctcga gaacttcgtc cgccatagca accgcgtcaa taacatcgac      4440
     ccgatcgagg gcatgtccat gatggacatc gcgagcgtgt gcgcggcgga gaggagggcg      4500
     aggggagaac cctggcgggg gaaggacgcg gcgggtcagc cgaggcggat ggcggactga      4560
//

If you have problems or comments...

PBIL Back to PBIL home page