(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE258

MICSR_1.PE258        Location/Qualifiers
FT   CDS_pept        join(520294..520470,520585..521292)
FT                   /codon_start=1
FT                   /gene_family="HOG000264640" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636598"
FT                   /orf_name="MICPUN_80015"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /protein_id="ACO61718.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="HOGENOM:HBG560091"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018664"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000199AC3B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D5"
FT                   /transl_table=1
FT                   /translation="MRALEKGEPVSGRVEVANRGGLILRIFNGRFRAFLPLSQMTSSRT
FT                   LDVKRSRKKNAPKSAQVGKVIEVKVTDVNDKKIVVSERALVQERGVKRLKPGVRASAQV
FT                   VSLSDFGAFVELSQDDPQAPRLEGLIHISELSWSRVAHPRDILRVGDEVDVKVLDVAPA
FT                   EGRRPARVTFSLKQLQADPLLETLDTIMPVAMPEPSVDEDELLDTPLPGLMDICSNLLT
FT                   EEGIDAVIPGRQAVEQRVVSQDLELWLTNVVVEDGYNLLARAGRQVQEIHVVTKLSRDS
FT                   IKMAIKRATSALK"
     atgcgcgcgc tcgagaaggg cgagcccgtg agcgggcgag tcgaggtggc gaaccgcggc        60
     ggcctcatcc tccgcatctt caacggacgc ttccgcgcgt tcctcccgct ctcgcagatg       120
     acctcatcca ggaccctcga cgtcaagcgc agcaggaaga agaacgcgcc aaagtccgcg       180
     caggttggta aggtcatcga ggtgaaggtc accgacgtca acgacaagaa gatcgtcgtc       240
     tccgagcgcg cgctggtcca ggagcgcggt gtcaagaggc tcaagcccgg cgtccgagca       300
     tccgcgcagg ttgtctccct ctccgatttt ggcgcctttg tggagctctc gcaggacgat       360
     ccccaggcgc ccaggctgga gggactcatc cacatctccg agctctcgtg gtccagggtg       420
     gcgcacccgc gcgacatcct gcgcgtgggc gacgaggtgg acgtcaaggt gctcgacgtc       480
     gcgccggcgg aggggaggag gcccgcgagg gtcacgtttt cgctgaagca gctccaggcg       540
     gacccgctgc tggagacgct cgacacgatc atgccggtgg cgatgcccga gccctcggtg       600
     gacgaggacg aacttttgga taccccgctc ccgggcctga tggacatctg ctccaacctg       660
     ctgacggagg agggcatcga cgcggtgatc ccggggcggc aggcggtgga gcagagggtg       720
     gtgagccagg atctggagct gtggctgacc aacgtcgtcg tcgaagacgg gtacaacctg       780
     ctcgcgcgcg cgggacggca ggttcaggag atccacgtgg tgacgaagct gagcagggac       840
     agcatcaaga tggccatcaa gcgcgccacc agcgcgctca agtga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page