(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE259

MICSR_1.PE259        Location/Qualifiers
FT   CDS_pept        complement(521409..522164)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636599"
FT                   /orf_name="MICPUN_56834"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62153.1"
FT                   /db_xref="InterPro:IPR013583"
FT                   /db_xref="UniParc:UPI000199AC3C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D6"
FT                   /transl_table=1
FT                   /translation="MVAALGGDARAAGAAAPKPEINVAKLTKAEEAIFTLQPGKDAFVK
FT                   LAAALAPFRPVVDHVADALSWRSTRKAMAAQAAFTYAVLYPYVIIPGILLTLGTCTLTN
FT                   RKEDEGSGDEDDGETRSEPAKKKPTPAEPKGASWRSKARKLDARDVQRALENVATRLER
FT                   IIALTTWEDPVVTGAFVAGCLVAALFLASHSFQVVLLCVGLYATRPPSWRVVPGPLESL
FT                   LGRMPDKGEAYARLMQETGNGGKGAASGA"
     atggtggccg cgctgggggg cgacgcgcgc gccgccggcg ccgccgcgcc caagcccgag        60
     atcaacgtcg ccaagctcac caaggctgag gaggcgatat tcaccctcca gcccggcaag       120
     gacgccttcg tcaagctcgc cgcggcgctc gcgcccttca ggcccgtcgt cgatcacgtc       180
     gccgacgcgc tctcctggcg gagcactcgc aaggccatgg ccgcgcaggc tgcctttacg       240
     tacgcggtgc tctaccctta cgtgatcatc ccgggaattc tgctcaccct gggcacgtgc       300
     acgctgacga acaggaaaga agacgagggg tccggcgacg aggacgacgg cgagacgcgg       360
     tccgagcccg ccaagaagaa gccgacgccc gccgagccca agggcgcgag ctggcgatcc       420
     aaggcgagga aactggacgc gcgagacgtt cagcgcgcgt tggagaacgt cgcgacgagg       480
     ctcgagcgaa tcatcgcgct cacgacgtgg gaagatcccg tggtcaccgg cgcgttcgtc       540
     gcggggtgcc tggtcgcggc gctcttcctc gcgtcgcact cgttccaggt ggttttactg       600
     tgcgtcggat tgtacgcgac gaggccgccg tcgtggcggg tcgtgccggg gccgctggag       660
     agcctcttgg ggcgcatgcc ggacaagggc gaggcgtacg cgaggctgat gcaggagacg       720
     gggaatgggg gcaagggcgc cgcctcgggc gcgtga                                 756
//

If you have problems or comments...

PBIL Back to PBIL home page