(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE26

MICSR_1.PE26         Location/Qualifiers
FT   CDS_pept        45722..47734
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636031"
FT                   /orf_name="MICPUN_56598"
FT                   /product="Fused protein"
FT                   /protein_id="ACO61597.1"
FT                   /db_xref="HOGENOM:HBG560093"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199AABC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q3"
FT                   /transl_table=1
FT                   /translation="MVLTVTSLLEVDGCPPIKLREERDNEDVPLRTGCRVWSCARLLAE
FT                   WLANRSGGGEDDGAGPIVVGRDVLELGAGTGAVGLTCAALGASSVTMTDRDEAALALMH
FT                   TNARINGHYDASSTCEVCVQGLDWGDPATYIQGASYDLVVAADVLYLPEHCAALPDAVA
FT                   AHLAPGGEVVVACGLRRAGLLEALVDSLRSVGLDDVCVDLGTLGLDPVDGADARNRAAA
FT                   AVTASEHAHDGAQISAAGGYALVTASVKADWKPPERLSARAVADAKREREEEERNEEER
FT                   NEAERNEADRPRIRGEGNRTPGAVASETAATREEDQLGGEPSEIDSDANSAMGDFLDDF
FT                   EDLGVDAGAPVTRAVPASDDDDEDEVDTLPPYRVHPSPAEVASGAPSASTIAAAADSLA
FT                   RNGFVVLEAEDGAGLVASDVLDSALAASDGYLDRLLAAAKAKGLRVDSDIFRFAELCSR
FT                   AQGGRRFDVTAERRRCGNGGSITLPPRPYPTSDDESAAAAATDAWDGLRRAVDPWVSSA
FT                   LLRSGLMVENDGKGATFGVTAVGCVTSLPSAPEQHFHADGRERGIVNVFVPLVDVPASM
FT                   GPTHFRRGSHAWDHDSPYLTREQRRAQEGAEDVVPELRRGSVLMYDYRVFHRGGANLTG
FT                   KRRPVAYVMYARDGTEDTWNFPDESVWDPDSTGAG"
     atggtgctca cggtgacgtc gctgctcgag gtggatgggt gcccgccgat aaagctgcgg        60
     gaggagcgcg acaacgagga cgtgcccctg cgcacgggct gtcgcgtgtg gtcgtgcgca       120
     cgcctcctgg cggagtggct cgccaacagg agcggcggcg gcgaagatga tggcgccggt       180
     cccatcgtcg tcggccgcga cgtcctggag ctcggagccg gcacgggcgc cgtgggcctc       240
     acgtgcgcgg ccctcggcgc aagttccgtc accatgaccg acagggacga ggccgcgctc       300
     gctctcatgc acaccaacgc gcgcataaac gggcactacg acgcatcctc gacgtgcgag       360
     gtgtgcgtcc agggcctcga ctggggcgac cccgccacct acatccaggg cgcgagctac       420
     gacctcgtcg tcgccgcgga tgtcctctac ctaccggagc attgcgccgc gctccccgac       480
     gccgtggccg cgcacctagc gcccggaggt gaggttgtcg tcgcgtgcgg gcttcgacgc       540
     gccgggctcc tcgaagcgct ggtggactcg cttcgatcgg tgggtctgga cgatgtctgc       600
     gtggacctcg gcacgttggg gctcgacccc gtagatggcg ccgatgcacg caacagggca       660
     gccgcggcgg tcaccgcgag cgagcacgcg cacgacggcg cgcagatatc cgccgcgggc       720
     gggtacgcgt tggtgacggc gtcggttaag gcggactgga agccgccgga gaggctgtcc       780
     gctcgggcgg tggcggacgc gaagcgggag agggaggagg aggaacggaa cgaggaggaa       840
     cggaacgagg cggaacggaa cgaggcggat cgaccgcgga ttcgcggcga agggaaccga       900
     actcccggcg ccgtcgcctc ggagacggcg gcgacccggg aagaggacca gctcggcggg       960
     gaacccagcg agatcgactc ggacgccaac agcgccatgg gcgactttct cgacgacttc      1020
     gaagacctcg gcgtggacgc cggcgcgccc gtgacgcgtg cggtcccggc gtctgacgac      1080
     gacgacgagg acgaggtcga taccctcccg ccgtaccgcg tgcacccatc cccggcggag      1140
     gttgcctccg gggcaccctc cgcctccacc atcgccgccg cggcggactc gctcgcgagg      1200
     aacgggttcg tggtcctcga ggcggaagat ggcgcgggtc tggtcgctag cgacgtgctc      1260
     gactccgcgc tggctgcgag cgacggctac ctggaccgac tcttggcggc ggcgaaggcg      1320
     aagggccttc gggtggattc cgacatcttc aggttcgcgg agttgtgcag ccgcgctcag      1380
     gggggacgta gatttgacgt caccgccgag cgaaggcggt gcgggaacgg cggctcgatc      1440
     accctcccgc cgaggcccta tcccacctcg gatgacgagt cggcagccgc agccgcgacg      1500
     gatgcgtggg acgggttacg tcgcgcggtg gacccctggg tctcctccgc gctcctcaga      1560
     tcgggtctca tggtcgagaa cgacgggaaa ggtgcgacgt ttggcgtcac cgcggttggg      1620
     tgcgtcacgt cgctgccgtc cgcgcccgag cagcacttcc acgccgacgg gagggagcgg      1680
     ggcatcgtga acgtcttcgt gccgctggtc gacgtccccg cctcgatggg acccacgcac      1740
     tttcgccgcg ggtcgcacgc gtgggatcac gactccccgt acctgactag ggagcagaga      1800
     cgggcccagg agggcgcgga ggatgtggtt cccgagctga ggcgcgggtc cgtattgatg      1860
     tacgattaca gggtgttcca ccggggcggc gccaacctga cgggcaaacg gaggccggtg      1920
     gcgtacgtca tgtacgcgcg cgacgggacg gaggacacgt ggaactttcc ggatgagtcg      1980
     gtgtgggacc cggacagcac cggcgccgga tga                                   2013
//

If you have problems or comments...

PBIL Back to PBIL home page