(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE260

MICSR_1.PE260        Location/Qualifiers
FT   CDS_pept        522478..523869
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636600"
FT                   /orf_name="MICPUN_56835"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="amino sugar metabolic process "
FT                   /biological_process="peptidoglycan turnover"
FT                   /protein_id="ACO61719.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006040"
FT                   /db_xref="GO:0009254"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniParc:UPI000199AC3D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D7"
FT                   /transl_table=1
FT                   /translation="MTRRVGIGLTAGPSLATIDAALVEIDPNPIRLKPVELIEFLPVPV
FT                   PPDLRARLVVARSGAAATPAAMSELDTEVGKLLADAAKKVAGARLGEVEFIASCGMPVV
FT                   RTSASSEESKSDDGAGAPPEVVRIGDAAVLARDTAKCVVSDFVPAESDETGVFSTADAV
FT                   LFRHLLDDTRTVEWHRKPTADTSCALVVVHFGAMASMTALSGTGRVLRSFDCGPGNMVM
FT                   NLIVQNAAALGLEPKDPKDEALAEKLQQPGGMRFDEGGKIAKGGRVYHGRTKDAPIDFA
FT                   WTAPFFTRSPVRRGSEADFGMEFTKTFVNRFPKEPPVRFAEVGKEWRNVNDVVRTALEH
FT                   AALCVMEGIASHVGAVSGSGNHLMGHSGSTGRVLISGGGAYNWALMARLRELGWKNLRF
FT                   ETSTECGIRADAAQAMRAATLGYLTLSGVAGPGDGEAAEGAGGAALGKVYTPGGDPAPV
FT                   FEPVK"
     atgacccgtc gcgtcggcat cggcctcacg gccggtccct cgctggcaac catcgacgcg        60
     gcgctcgtcg agatcgaccc caatcccatc cggctcaagc cggtggagct catcgagttc       120
     ctccccgtgc ccgtcccgcc cgacctgcgg gcccggctcg tggtcgcgag gtcgggggcc       180
     gccgcgaccc ccgcggcgat gtcggagctc gataccgagg tcgggaagct cctggcggat       240
     gccgcgaaga aagtcgcggg ggccaggctc ggggaggtgg agttcatcgc ctcgtgcggg       300
     atgcccgtag tgcggacgtc ggcgtcgtcg gaggagtcca aatctgacga cggggctggt       360
     gctccaccgg aagtcgtgag gataggcgac gcggccgtcc tggcgcggga caccgcgaag       420
     tgcgtcgtgt ccgacttcgt acccgcggag tcggacgaga ccggcgtctt ctccaccgcc       480
     gatgccgtgc tgttccgcca ccttctggac gacacgcgaa cagtcgagtg gcatcgcaag       540
     ccaaccgcgg acaccagttg cgcgttggtg gtggtgcact tcggcgccat ggcgtccatg       600
     accgcgctgt cgggcaccgg gcgggtgctc cggagcttcg actgcgggcc ggggaacatg       660
     gtcatgaacc tcatcgtgca aaacgcggcg gcgctgggcc tcgagcccaa ggatccgaag       720
     gacgaggccc tcgcggagaa acttcaacaa ccggggggga tgcggttcga cgagggcggg       780
     aagattgcaa aaggggggcg cgtctaccac ggccgcacca aggacgcgcc gatcgacttc       840
     gcgtggacgg cgcccttctt cacgcggtcg ccggtgagaa ggggctcgga ggcggacttt       900
     gggatggagt tcacgaagac gttcgtcaat cgcttcccga aggaaccgcc cgtgaggttc       960
     gccgaggtgg gcaaggagtg gcgcaacgtc aacgacgtcg ttcgcacggc tctggagcac      1020
     gcggcgctgt gcgtcatgga gggcatcgcc tcgcacgtgg gcgcggtctc cggaagcggc      1080
     aaccacctga tgggtcactc cgggagcacc gggagggtgc tcatctccgg cggcggcgcg      1140
     tacaactggg cgctgatggc ccggctgagg gaattggggt ggaaaaacct tcgtttcgag      1200
     acgagcacgg agtgcggcat tcgcgccgac gcggcgcagg cgatgcgagc ggcgacgctc      1260
     gggtacttga ccctgagcgg cgtggccggg cccggggatg gcgaggcggc ggagggcgcg      1320
     ggcggggcgg ccctcgggaa ggtgtatacg ccggggggcg acccggcgcc ggtgttcgag      1380
     cccgtcaagt ag                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page