(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE261

MICSR_1.PE261        Location/Qualifiers
FT   CDS_pept        524138..525628
FT                   /codon_start=1
FT                   /gene_family="HOG000006181" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636601"
FT                   /orf_name="MICPUN_113552"
FT                   /product="PfkB family carbohydrate kinase "
FT                   /function="ribokinase activity"
FT                   /biological_process="D-ribose metabolic process "
FT                   /protein_id="ACO61720.1"
FT                   /db_xref="GO:0004747"
FT                   /db_xref="GO:0006014"
FT                   /db_xref="HOGENOM:HBG560095"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="UniParc:UPI000199ACAB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D8"
FT                   /transl_table=1
FT                   /translation="MQSLQAPTLALGVSEGAKRRAVAGSRLARPVSVRHHRRVAIRNNA
FT                   VFADADQAQRWIDAWKARLNAPRVVGVGSAGVDYLASVAAFPEPDQKLRTDAFETQGGG
FT                   NCGNALTAVARLGLRPSILTKLSDDGAGKAILDELRDDGVDTAHVVIEPGKSSPFTYII
FT                   VDREGSTRTCIHTPGPEFTPKEMPLAAIERLLDGASLCYFDGRLTEVAIEVAKVAKARG
FT                   VPVLVEGERLRDNLPALLALGDYVCTSANYPQDSNPDAPGFEAAMVAMASKLPAAKAIV
FT                   TTLGSRGAVCLVRAPAQAGKAPSRAESLADVVSKLEKDAAVGMPAGSRGVPVPAWPVVS
FT                   DAVVLTDAGDEAAAALGAVEVIFAPAVKLQKSSVVDTTGAGDAFIGSMCYGVATGMELK
FT                   DAMRLGAYVAAKKCGSLGARPGLPDISEVPEAVFQGKEKPKVAAAAVNKTASRPPAVRK
FT                   AKAPREMTDIDKEFADGTRKSIAPGLSKWMLKLGRRYQ"
     atgcaatccc tgcaagctcc cacgctcgcg ctcggcgtct ccgagggtgc caagcgccgc        60
     gccgtcgccg gctcgcgcct cgcccggccc gtctccgtga ggcatcatcg tcgggtcgca       120
     attcgtaaca acgccgtttt cgccgacgcc gaccaggccc aacggtggat cgacgcgtgg       180
     aaagcccggc tcaacgcccc cagggtcgtg ggagtcggca gcgccggagt ggactacctc       240
     gcgtccgtcg cggccttccc cgagcccgac cagaagctcc gcaccgacgc cttcgaaact       300
     cagggtggcg gaaactgcgg caacgccctc accgcggtcg ccaggctcgg cctgaggcca       360
     tccatcctca cgaaactctc cgacgacggg gcgggcaagg ccatcctgga cgagctccgc       420
     gacgacggcg tggacaccgc gcacgtcgtc atcgagcccg gcaagagctc cccgttcacg       480
     tacataatcg tcgatcgcga gggatccacc cgtacctgca ttcacacccc ggggcccgag       540
     ttcaccccga aggagatgcc gctcgccgcc atcgagcgcc tcctcgacgg cgcttcgctg       600
     tgctatttcg acggcaggct caccgaggtg gccatcgagg tggccaaggt ggccaaggcg       660
     cgcggcgtgc ccgtgctcgt ggagggcgag cgcctgcgcg ataatctccc ggcgctgctc       720
     gccttgggag actatgtctg caccagcgcc aactacccac aggactcgaa tccggacgcg       780
     ccgggcttcg aggcggcgat ggtggcgatg gcgtccaagc tcccggccgc caaggcgatc       840
     gtcacgaccc tcggatcccg cggcgcggtc tgcctcgttc gcgcgcccgc ccaagccggg       900
     aaggcgcctt cgagggccga gtccctggcc gacgtcgtgt cgaaactcga gaaggacgcg       960
     gcggttggta tgcccgccgg ctccaggggc gtgccggtcc ccgcgtggcc cgtggtctcc      1020
     gacgcggtcg tgttgacgga cgcgggcgac gaggcggccg cggcgctcgg ggcggtggag      1080
     gttatcttcg cgccggcggt gaagctgcaa aaatcgtcgg tggtggacac gacgggagcc      1140
     ggggacgcgt tcatcgggtc gatgtgctac ggcgtcgcga cggggatgga gctgaaggac      1200
     gccatgcgac tgggcgcgta cgtcgcggcg aaaaagtgcg gttcgctcgg ggcgaggccg      1260
     ggtctgccgg acatctcgga ggtgcccgag gctgtgttcc agggcaagga gaagccgaag      1320
     gttgccgccg ccgcggtgaa caagaccgcg tcgaggccgc cggctgtgcg gaaggcgaag      1380
     gcgccgcggg agatgaccga catcgacaag gagtttgcgg acgggacgag gaagtcgatc      1440
     gcgccgggtc tgagcaagtg gatgctgaag ttgggacgca ggtatcagtg a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page