(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE264

MICSR_1.PE264        Location/Qualifiers
FT   CDS_pept        complement(529619..529954)
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636604"
FT                   /orf_name="MICPUN_107897"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62155.1"
FT                   /db_xref="UniParc:UPI000199ACAE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E1"
FT                   /transl_table=1
FT                   /translation="MTEVFCEEQGEGATGTFRTLGVSGALNAAVAVAAETANAPPAARG
FT                   RGGSAAKPTGGESVCQSERDSRPGYEYLTAAELRRVGAKMSVGGRGLERVERSGGQYYL
FT                   QSARDYD"
     atgacggagg ttttctgcga ggagcagggc gagggggcga ccgggacgtt ccgcacgctg        60
     ggcgtgagcg gggcgctgaa cgcggcggtg gcggtcgcgg cggagacggc caacgcgccg       120
     cccgccgccc gagggagggg gggttcggcc gcgaagccga ccggcggcga gtcggtctgt       180
     cagtcggagc gagactcgcg cccggggtat gaatatctca ccgcggcgga gctgcggcgg       240
     gtcggggcga agatgtccgt gggcgggcgc gggctggagc gcgtggagcg ctcggggggg       300
     cagtactacc tccagtccgc gcgcgactac gactga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page