(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE265

MICSR_1.PE265        Location/Qualifiers
FT   CDS_pept        531669..532547
FT                   /codon_start=1
FT                   /gene_family="HOG000100017" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636605"
FT                   /orf_name="MICPUN_56841"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61722.1"
FT                   /db_xref="HOGENOM:HBG717200"
FT                   /db_xref="UniParc:UPI000199ACAF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E2"
FT                   /transl_table=1
FT                   /translation="MNTIWHPLLLNRDPIVVKEESDDDHHNPPAVNVEPPADDHGEDEK
FT                   TEDLAGKMSTIWRPNLGRLYASVAEMEGSESEEEKEDATKKGVKRKRAPRTKGPCEHGV
FT                   KYRSNCKVCGACPHGKWRSRCKECGGSGICEHGRQRSKCKECGGASICEHSRQRSQCKE
FT                   CGGSQICKHGRRRSRCKECGGSGICEHGRQRSKCKECGGSQICEHDRIRSQCKECGGSQ
FT                   ICKHGRRRHYCKECGGSQICEHGRQRHRCKECGGSQICEHDRIRSQCKECGGSEICEHG
FT                   RRRSECKECKK"
     atgaacacca tctggcaccc actactcttg aacagagacc ccatcgtcgt caaggaagag        60
     tccgacgacg accaccacaa cccccccgcc gtcaacgtcg aacctcccgc ggacgaccat       120
     ggggaagacg aaaagacgga ggatctcgca gggaagatgt cgacgatttg gcgacccaac       180
     ctcggccggc tgtacgccag cgtcgccgag atggagggat cggagagcga agaggagaag       240
     gaggatgcga cgaagaaggg cgtgaagcgg aagagagccc ctcgcacgaa ggggccgtgc       300
     gagcacgggg tgaagtatcg gtcgaactgt aaggtgtgcg gtgcttgtcc ccacgggaag       360
     tggcgctctc ggtgcaagga gtgcggcggg tctggaatct gcgagcacgg tcgtcagcgc       420
     tctaagtgca aggagtgtgg cggggcatca atctgcgagc acagccgtca gcgctctcag       480
     tgcaaggagt gcggtgggtc tcagatctgc aagcacggcc gtcggcgctc tcggtgcaag       540
     gagtgcggcg ggtctggaat ctgcgagcac ggtcgtcagc gctctaagtg caaggagtgt       600
     ggcgggtctc aaatctgcga gcacgatcgt attcgctccc agtgcaagga gtgcggtggg       660
     tctcagatct gcaagcacgg ccgtcggcgc cattactgca aggagtgcgg tgggtctcag       720
     atctgcgagc acggtcgtca gcgccatagg tgcaaggagt gtggcgggtc tcaaatctgc       780
     gagcacgatc gtattcgctc acaatgcaag gagtgcggcg ggtctgaaat ctgcgagcac       840
     ggccgtcggc gctctgagtg caaggagtgc aagaaatag                              879
//

If you have problems or comments...

PBIL Back to PBIL home page