(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE266

MICSR_1.PE266        Location/Qualifiers
FT   CDS_pept        complement(<534147..>534443)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636606"
FT                   /orf_name="MICPUN_76642"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62156.1"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniParc:UPI000199ACB0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E3"
FT                   /transl_table=1
FT                   /translation="LETVRNLVFLDLYANAVEKIAGLECVPQLRVLMLGRNRIRSIGAG
FT                   LARLQRLDVLDLHNNEIASTSGLNSLASLRILNLAGNRLVSLGDLGNMTGLHEL"
     ctagagaccg tgagaaatct ggtgttcctc gacctgtacg ccaacgcggt ggagaagatc        60
     gccgggctcg agtgcgtgcc gcagctcagg gtgctcatgc tcgggcgcaa ccgaatcaga       120
     tccatcggcg ccggcttggc caggctccag aggctcgacg tcctcgatct ccacaacaac       180
     gagatcgcgt cgacgtcggg gctcaactcg ctcgcgtcgc ttcgtatcct gaacctcgcc       240
     ggtaacaggc tggtctccct cggcgacctc gggaacatga ccggacttca cgagctc          297
//

If you have problems or comments...

PBIL Back to PBIL home page