(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE267

MICSR_1.PE267        Location/Qualifiers
FT   CDS_pept        535341..536705
FT                   /codon_start=1
FT                   /gene_family="HOG000100024" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636607"
FT                   /orf_name="MICPUN_99400"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61723.1"
FT                   /db_xref="HOGENOM:HBG560099"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniParc:UPI000199ACB1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E4"
FT                   /transl_table=1
FT                   /translation="MGKLGELMGDSWDNAVKNNPIPVITKKMRKPGETAAYVRAQGSSL
FT                   FGIAEGLGLQYRMGAYTQVDDDLLDEDPGLNQLLVSTGSSISQLFTQDMWERHRGVSRY
FT                   WRHLATITKSTVFNRIVEPVLLIAAWATFWCLWNGTLVPVVQAFGEATLEASSGVAIVE
FT                   RIAGITGGVKFTHAVAVLASLAAPVCVPSTAHALAGTALGLVLVFRTNSASARLNEARV
FT                   LLGNMVRLVRDLTRLCQYIPEGDRRCEGVRRSVVRYAAAIGLAIEAHMRKGRTRVDPDD
FT                   PTAFKVDPSRNLTRIFGETEAKRIVNLPGASHNLPMVMNAQASKELRRALKAGMPHMIH
FT                   RECEEMVAELGKISGGAERIISTPIPLSYTRHTSRSLMIWLLTLPFALWETFHWATVPA
FT                   VFALTYLTIGLDEIGIQIEEPFSVLPVKPLADVCERDVRALDQLLELGGFPEGDR"
     atggggaagc tcggcgagct catgggagac tcctgggaca acgccgtgaa gaacaacccg        60
     atcccggtca tcacgaagaa gatgcgcaag cccggcgaga ccgccgccta cgtccgcgcg       120
     cagggctcct ccctcttcgg catcgccgag ggcctcgggc tgcagtaccg catgggcgcc       180
     tacacgcagg ttgacgacga tttgctcgac gaggacccgg gtctgaacca gctgctcgtg       240
     tccaccggca gctccatctc gcagctcttc acgcaggaca tgtgggagag acaccgaggg       300
     gtgtcgcgct actggcgaca cctcgccacc atcaccaaga gcaccgtgtt caaccgaatc       360
     gtcgagcctg tgttgctcat cgccgcgtgg gcgacgtttt ggtgcctctg gaacgggacc       420
     ctggtgcccg tggtgcaggc cttcggggag gccacgctgg aggcgtccag cggcgtcgcc       480
     atcgtggagc gcatcgcggg aatcaccggc ggggtcaagt tcacccacgc cgtcgccgtg       540
     ctcgcctccc tcgccgcccc cgtctgcgtc ccgtccacgg cgcacgcgct ggcgggaacc       600
     gcgctcggcc tcgtcctcgt ctttcgaacc aactcggcgt cggcgcggtt gaacgaagcg       660
     agggtgctgc tcgggaacat ggtcaggctc gtcagggacc tcaccaggtt gtgtcagtac       720
     atcccggagg gtgatcgaag gtgcgagggg gtgagacgga gcgtggtgag gtacgccgcc       780
     gccatcgggt tggccatcga ggcgcacatg cgcaaggggc gaacccgggt ggacccggac       840
     gatcccacgg cgttcaaggt ggatccgagc cgaaacctga cgaggatttt cggcgaaacg       900
     gaggcgaagc ggatcgtcaa cctgccgggc gcgagccata acctcccgat ggtgatgaac       960
     gcgcaggctt cgaaggagct gagacgggcg ctcaaggcgg ggatgccgca catgatccac      1020
     agggagtgcg aggagatggt ggcggagctc ggtaagatat ccggcggcgc cgagcgcatc      1080
     atcagcacgc cgatcccgct gtcctacacc aggcacacct cgcggtcgct gatgatatgg      1140
     ctgctgacgc tgccgtttgc gctctgggag acgttccact gggcgacggt gccggcggtt      1200
     ttcgcgctga cgtacctgac catcggcctc gacgagattg gcatccagat cgaggagccg      1260
     ttcagcgtcc tgcccgtcaa gcccctcgcg gacgtgtgcg agagggacgt cagggcgctg      1320
     gaccagctgc tggagctggg agggttcccc gagggcgaca ggtag                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page