(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE27

MICSR_1.PE27         Location/Qualifiers
FT   CDS_pept        complement(47829..48536)
FT                   /codon_start=1
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636032"
FT                   /orf_name="MICPUN_56599"
FT                   /product="Predicted protein"
FT                   /function="threonine-type endopeptidase activity "
FT                   /biological_process="proteolysis involved in cellular
FT                   protein catabolic process"
FT                   /cellular_component="proteasome core complex"
FT                   /protein_id="ACO62042.1"
FT                   /db_xref="GO:0004298"
FT                   /db_xref="GO:0005839"
FT                   /db_xref="GO:0051603"
FT                   /db_xref="HOGENOM:HBG499923"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="UniParc:UPI000199AABD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q4"
FT                   /transl_table=1
FT                   /translation="MADSRSNYSLTTFNSSGELVQIKHALAAVQSGATSLGIRAVNGVV
FT                   LATEKKLPSTLVDETTVEKIAQLTPEIGMTYSGMGPDFRVLTKKTRKETQVYYRTYHEL
FT                   VPCSQIVRETASVMQEFTQRGGVRPFGVSLLMAGFDSNGPQLYQVDPSGTYFAWKASAI
FT                   GKNMVNAKTFLEKRYSEDMELEDAIHTAILTLKEGFDGQISAENIEIGIVAEDRKFRVL
FT                   TSAEVADYLSEVE"
     atggcagact cgaggtcgaa ctactcgctc accaccttca actccagcgg cgagcttgtg        60
     cagattaagc acgcgctcgc cgcggtgcag agcggcgcga catctttggg catccgcgcg       120
     gttaacggcg tggttcttgc caccgaaaag aagcttccct cgacgctggt ggacgagacc       180
     accgtggaga agatcgcgca gctgacgccc gagattggca tgacctacag cgggatggga       240
     ccggacttca gggtgctgac gaagaagacc cgcaaggaga cgcaggtgta ctaccgcacc       300
     taccacgagc tcgtgccctg ctcgcaaatc gtgagggaga cggcgtcggt gatgcaggag       360
     ttcacccagc ggggaggcgt caggcccttc ggggtctccc tcctcatggc cggattcgac       420
     tccaacgggc cgcagctgta ccaggtggat ccctccggaa cgtacttcgc gtggaaggcg       480
     agcgcgatcg gcaagaacat ggtcaacgcc aagacgttcc tggagaagag gtactcggag       540
     gacatggagc tggaggatgc catccacacc gccatcctca cgctcaagga ggggttcgac       600
     ggtcagatca gcgcggagaa catcgagatc ggtatcgtcg cggaggacag gaagttcagg       660
     gtgctgacgt cggcggaggt ggcggattac ctgtccgagg ttgagtaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page