(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE271

MICSR_1.PE271        Location/Qualifiers
FT   CDS_pept        complement(541686..543254)
FT                   /codon_start=1
FT                   /gene_family="HOG000264642" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636611"
FT                   /orf_name="MICPUN_56847"
FT                   /product="Major facilitator superfamily "
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62158.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="HOGENOM:HBG609118"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000199ACB5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E8"
FT                   /transl_table=1
FT                   /translation="MLFMIASLAALGGFLFGYDLGLIAGALLYMEPDLRLTEASEELIV
FT                   GMAKLGAVFGTFVGGALMQEHGRRKAIAWNSGFFLLGPFIMAVGDDAATVSLGRFVVGM
FT                   GVGASAVVVPAYVAEMAPKDRRGSVVTVYELMVCLGMITSGLVDWGLRGVEHSWRWMVA
FT                   MPMFPAVLMLAGSAALPESPRWLVIRGRLRDALDVIHSLREGSGVDRDGEDVSTAAVEA
FT                   ELMELWSAVEKERAQVGEPAGEPDASAAADVGAAADVPAQKSATSSGIHGRGMLAVGIQ
FT                   MLRDIRGLTSGPERNAFAIALWLAFFNQATCSTSVINFAPEVLERVGVDSKDDAVLLAS
FT                   AVSLCKLLGVSASMFLVDRAGRRTLLLVGSHAAAAAMAGLAIAYDAGDAFGSLLCMCVF
FT                   MLAFSASWAGVFWVVLSELFSMRVKSAAVSAAAATLFATGAFTDFVFLSAARAMGGWAF
FT                   GAVACVCVCAGVYVQRNLPETAGKSLAEVQAVMAAGTGARGEGPGWLTRLRRGPAAGGR
FT                   YVEMS"
     atgttgttca tgatcgcgtc gctcgcggcg ctcggggggt ttctcttcgg ctacgacctc        60
     ggcctgatcg ccggcgcctt gctctacatg gagcccgatc tgcgactcac ggaggcgtcg       120
     gaagagctga tagtcgggat ggcaaagctg ggcgcggtct tcggcacgtt cgtcggcggc       180
     gcgctgatgc aggagcacgg cagaaggaag gccatcgcgt ggaacagcgg tttcttcctc       240
     ctcgggccgt ttatcatggc cgtgggcgac gacgccgcga cggtctccct gggaaggttc       300
     gtggtgggga tgggggtggg ggcatccgca gtcgtggtcc cggcgtacgt tgccgagatg       360
     gcgccgaagg accggcgcgg gtccgtggtg accgtatacg agctgatggt gtgcttgggc       420
     atgataacct ccgggctcgt ggactggggg ctgcggggcg tcgagcacag ctggcggtgg       480
     atggtggcga tgccgatgtt cccggcggtt ttgatgctcg ccgggtccgc cgcgctgccc       540
     gagtcgccgc ggtggctcgt catccgcggg aggcttcgcg acgcgctcga cgtcatccac       600
     tccctgcgcg agggttccgg ggtggacagg gacggggagg acgtcagcac ggctgccgtg       660
     gaagccgagc tgatggagct gtggtcggcg gtggagaagg aacgcgccca agtcggagag       720
     cccgccggag agcccgacgc gagcgccgcc gctgacgtag gcgccgccgc cgacgtcccc       780
     gcgcaaaagt cggccactag tagcgggatc cacgggcgcg ggatgctcgc cgtcgggatc       840
     cagatgttgc gcgacatccg gggcttaacc tcgggtcccg agcgcaacgc tttcgcgatt       900
     gcactgtggc tggcgttctt caaccaggcc acgtgctcca cctcggtcat caacttcgct       960
     cccgaggttc tcgaacgcgt gggcgtcgac tcgaaagacg acgccgtgct cctcgcgtcc      1020
     gcggtgtcgc tgtgtaagct cctcggcgtc tccgcgtcga tgtttttggt ggacagggcg      1080
     ggccgccgga cgctgctcct cgtcgggtcg cacgccgcgg cggcggcgat ggccggcctg      1140
     gcgatcgcct acgacgcggg cgacgcgttc gggtccttgc tgtgcatgtg tgtcttcatg      1200
     ctcgcgttca gcgccagctg ggccggggtg ttttgggtcg tgctgtcgga gctgttcagc      1260
     atgcgggtca agtcggcggc ggtgtccgcg gcggcggcga cgctcttcgc gacgggcgcg      1320
     ttcacggatt tcgtgttcct gtccgcggcg agggcgatgg gcgggtgggc gttcggggcg      1380
     gtcgcgtgcg tgtgtgtgtg cgccggagtc tacgtgcaac ggaacttgcc ggagacggcg      1440
     ggaaaatcgc tcgccgaggt tcaggcggtg atggcggcgg gcacgggagc acgcggggaa      1500
     gggccgggat ggctgacgcg gctgcgccgg ggccccgccg cgggtgggag gtacgtggag      1560
     atgtcgtag                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page