(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE272

MICSR_1.PE272        Location/Qualifiers
FT   CDS_pept        543380..544528
FT                   /codon_start=1
FT                   /gene_family="HOG000264643" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636612"
FT                   /orf_name="MICPUN_56848"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61726.1"
FT                   /db_xref="HOGENOM:HBG560103"
FT                   /db_xref="UniParc:UPI000199ACB6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E9"
FT                   /transl_table=1
FT                   /translation="MSGSPPLTPSRAEGDVKGLRRGMNALATMNGARAMAPSGAVARAR
FT                   APDTRATASRVYARRVGTSRGTLLAKVPSRLGRPHSWRPQLPPKRRRAITRAADDPERR
FT                   RPGFNKKRLASPKFSEEAQTWALLGGIATSLTAIVAVVVAANNEAAYFGSPDDFSYMGD
FT                   DFTGGPSLDVSPGNVAAAAIWSFGLFFKSPLQILLVFLGRTDTERPSDWLLRKSSGVTE
FT                   ETRTWEEASAPQKAALIAFFTVCGCGVVSGIDALFAGEETWALSAGLGFTMLAFVAELG
FT                   SPRRYSRAELDVLEAQYDDFVAFADEALERRGRCHGSEVERAFRRRFGKYTEAVLSDRD
FT                   LRTMILNWHPNAERTSSGYYKNLSVKEGVDRRNPVTVKDLGL"
     atgagtggct ctccgccgct cacaccatcg cgcgcggagg gcgacgtgaa gggccttcgg        60
     agaggaatga acgcgctcgc gacgatgaac ggagcccgcg cgatggctcc gagcggcgcg       120
     gtcgctcgag cccgcgcgcc cgatacccgc gcgaccgcgt cgcgcgtgta cgcccggcgg       180
     gtgggcacgt ctcgaggaac tctcctcgcg aaagtcccgt cgcgactcgg gcgtccgcac       240
     agctggcgtc cccaactccc gccgaaacga agacgagcga tcacgcgcgc ggccgacgat       300
     cccgagcggc gccgccccgg gttcaacaag aagcgcctcg cgtcgcccaa gttcagcgag       360
     gaggcgcaga cctgggcgct gctcggcggg atcgcaacct ccctcaccgc catcgtcgcc       420
     gtcgtcgtcg ccgccaacaa cgaggcggcg tacttcggct cgcccgacga tttctcgtac       480
     atgggcgacg acttcaccgg cggcccgtcc ctcgacgtca gcccggggaa cgtcgccgcg       540
     gcggcgatat ggagcttcgg gctcttcttc aagtccccgc tgcagatcct gctggtgttt       600
     ttgggaagga cagacacgga gcgcccgagc gattggctcc tgcgcaagtc ttcgggggtg       660
     accgaggaaa cgcgcacgtg ggaggaggcg tccgcgccgc aaaaggcggc gctcatcgcc       720
     ttcttcaccg tctgcggctg cggcgtcgtc tccggcatcg acgcgctctt cgccggggag       780
     gagacgtggg cgctctccgc gggactcggg ttcacgatgc tggccttcgt cgcggagctc       840
     gggtccccga ggcggtacag cagggcggag ctggacgtgc tcgaggcgca gtacgacgac       900
     ttcgtggcgt tcgcggacga ggcgctggag cggcgcggga ggtgccacgg gagcgaggtg       960
     gagcgagcgt ttcggaggag gttcggcaag tacaccgagg cggtgctcag cgacagggat      1020
     cttcggacga tgatcctcaa ctggcacccc aacgcggagc ggacgtcatc ggggtactac      1080
     aagaacctca gcgtcaagga gggggtggac aggcggaacc cggtgacggt gaaggatctg      1140
     gggctgtga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page