(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE273

MICSR_1.PE273        Location/Qualifiers
FT   CDS_pept        544717..546186
FT                   /codon_start=1
FT                   /gene_family="HOG000180745" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636613"
FT                   /orf_name="MICPUN_56849"
FT                   /product="RNA binding protein"
FT                   /function="RNA binding"
FT                   /function="nucleotide binding"
FT                   /biological_process="mRNA processing"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO61727.1"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006397"
FT                   /db_xref="HOGENOM:HBG558924"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006529"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="UniParc:UPI000199ACB7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F0"
FT                   /transl_table=1
FT                   /translation="MPEERERSRDRRDRRRDDSRDRRRRRSYSRSRSRSATPPPRQRRR
FT                   PTGFSDAPPPGFSGADGAVGGAGVPPGMGIGGADIPPGMNVSVAGAPSGFSGPPPGYAN
FT                   AHPGNLGLNPVPNQQATRHARRVYVGNLPGTVTEPKVAAFFNNAMHAIGGTVAALPGDP
FT                   VLNVYINYEKKFAFVEFRTVEETSNCMALDGAVLEGIAMRVRRPNDYNVMAASSLGPSQ
FT                   PKDGLNLEAIGLNPAAAGGGGAGAANASLTEEDLQHRLFIGGLPYFLTETMVKELVEAF
FT                   GPTKQFQLVVDRETGNSKGYGFFVYQDHSVTDVACQGLHGMKMGEKSLTVQRAMQGGAG
FT                   APKPTAASVGPGHTALPGADEVAAHLAGASGAPAGLSVPPPPSEHPASRVVSLTEMLDV
FT                   EELRDDVEYGEIMEDMREECGKFGRIESIVIPRPGDADGAAVPGLGKVFVRYEDDAGAA
FT                   AARNALHGRKFGGNVVKADFIDETVFASRAF"
     atgcccgagg aaagggagcg atcgcgcgat cgccgcgacc gacgcaggga cgactcgcgc        60
     gaccgtcgaa ggcgtagatc gtacagccgc agccgctcgc gctcggcgac gcccccgccg       120
     cgccagcgac gccgacccac cggattcagc gacgccccgc cgcccgggtt cagcggcgcg       180
     gatggcgcgg tcggcggcgc gggcgtcccg cccggcatgg gcatcggcgg cgccgacatc       240
     ccgcccggta tgaacgtatc ggtcgcgggc gcgccctccg gcttctccgg cccgccgccc       300
     ggctacgcca acgcccatcc gggcaacttg ggattaaacc cggtgcccaa ccaacaagcg       360
     acgcgacacg cgcgcagggt gtacgtcggc aacctccccg ggacggtcac cgaacccaag       420
     gtggcggcgt tcttcaacaa cgcgatgcac gccatcggcg gcaccgtcgc cgcgctcccc       480
     ggcgaccccg tcctcaacgt gtacatcaac tacgagaaga agtttgcctt tgtcgagttt       540
     cgcacggtcg aggagacttc aaactgcatg gcgctcgacg gggcggtgtt ggagggcatc       600
     gcgatgcgcg tgcgcaggcc caacgactat aacgtcatgg cagcctccag cctcggcccg       660
     tcccaaccca aggacgggct caacctcgaa gccatcggcc tcaatcctgc ggcggcgggg       720
     gggggcggcg ccggcgcggc gaacgcgtcg ctgaccgagg aggacctcca acaccggctc       780
     ttcatcggcg gactcccgta cttcctcacc gaaacgatgg tcaaggaact cgtcgaggcg       840
     ttcgggccca cgaagcagtt ccagctcgtg gtggacaggg agacgggcaa cagcaagggg       900
     tacgggttct tcgtgtacca ggaccactcc gtgacggacg tggcgtgcca gggcctgcac       960
     gggatgaaga tgggggagaa atcgctcacg gtgcagcgcg cgatgcaggg gggcgccggc      1020
     gcgcccaagc ccaccgccgc gagcgttggt cccggacaca cggcgctgcc gggcgcggac      1080
     gaggtcgccg cgcacctggc gggcgcatcc ggcgcgccgg ctggtctgtc ggtgccgccg      1140
     ccgccgagcg aacatcccgc gtcgagggtg gtctcgctga cggagatgct cgacgtggag      1200
     gagctcaggg acgacgtgga gtacggcgag atcatggagg acatgaggga ggagtgcggg      1260
     aagttcgggc ggatcgagag catcgtcatc ccgcggcccg gcgacgcgga cggcgccgcc      1320
     gtgccgggcc tcgggaaggt tttcgtgcgt tacgaggacg acgcgggcgc ggcggcggcg      1380
     aggaacgcgc tgcacgggcg caagttcggc ggcaacgtgg tcaaggcgga cttcatcgac      1440
     gagacggtgt tcgcctcgcg cgcgttctag                                       1470
//

If you have problems or comments...

PBIL Back to PBIL home page