(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE274

MICSR_1.PE274        Location/Qualifiers
FT   CDS_pept        complement(546291..547241)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636904"
FT                   /orf_name="MICPUN_56850"
FT                   /product="Predicted protein"
FT                   /function="3'-5' exonuclease activity"
FT                   /function="nucleic acid binding"
FT                   /biological_process="nucleobase, nucleoside, nucleotide and
FT                   nucleic acid metabolic process"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62159.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006139"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniParc:UPI000199ACB8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F1"
FT                   /transl_table=1
FT                   /translation="MSGGFAVLLDDVEDLAQDLARFALADAPASCSDRDASGSDGDDDG
FT                   HPRPRGADIVRVAPSTVAPPERPLTSTPPRVILLDDPGSCADAMRELIARGEPCAVDFE
FT                   GVALSRTGAISLAQVAPPNGPVYLVDVACMGAAAFDEGRLGELLGATHPLKLVFDCRGD
FT                   ADALHHQFGVRMRGVFDVQVAFCLKKDVDHGGKRGAYLMGLRKALKECPGLDDEARHEL
FT                   DAVKSAGASLFAPELGGSYDAWTKRPMHPDLVKYAAADVTYLHHMHRTWRGFCGEKKMA
FT                   AVTERRMRERIESPEGLEQGTEAAKRRGSRREKFF"
     atgtccggcg gtttcgcggt tttgctcgac gacgtcgagg atctcgcgca ggatctcgcg        60
     cggttcgcgc tcgcggacgc gccggcgtcg tgctccgacc gcgacgcgtc cggatcggac       120
     ggcgacgacg acggtcaccc tcgaccgcgc ggtgccgaca tcgtccgcgt cgctccgtcc       180
     accgtcgcgc cgcccgagcg cccgctgacg tcgacaccgc cgcgggtgat cctcctggac       240
     gacccgggat cgtgcgcgga cgcgatgcgc gagctcatcg cccgcggcga gccgtgcgcg       300
     gtggacttcg agggcgtcgc gctgtcgcgc actggcgcca tctctctcgc gcaggtggcg       360
     ccgccgaacg gacccgtcta cctcgtcgac gtggcgtgca tgggcgccgc cgccttcgac       420
     gagggccgcc tgggcgagct cctgggcgcg acgcacccgc tcaagctcgt cttcgactgc       480
     cgcggcgacg cggacgcgct ccaccaccag ttcggcgtgc gcatgcgcgg cgtcttcgac       540
     gtgcaagtgg cgttctgtct caagaaggac gtggaccacg gcgggaagcg aggcgcgtac       600
     ctcatgggcc tgcgcaaggc gctgaaggag tgcccggggt tggacgacga ggcacgtcac       660
     gagttggacg ccgtcaagtc cgcgggcgcg tcgttattcg ccccggagct gggaggttcg       720
     tacgacgcgt ggacgaagcg accgatgcat cccgacttgg tcaaatacgc cgcagccgac       780
     gtcacgtact tgcaccacat gcaccggacg tggcgagggt tttgcgggga gaagaagatg       840
     gcggcggtga cggagcgacg gatgcgggag aggatcgagt cccccgaggg gttggagcag       900
     gggacggagg cggcgaaacg acgggggtcc aggcgagaga agttcttctg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page