(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE275

MICSR_1.PE275        Location/Qualifiers
FT   CDS_pept        547768..550143
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636905"
FT                   /orf_name="MICPUN_56851"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61728.1"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniParc:UPI000199ACB9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F2"
FT                   /transl_table=1
FT                   /translation="MPRKRPKKNADDDGGSDECPLLSLAHQVMTPIAAHLDGDDLSALA
FT                   RTCVAMRRLCDGPQGRIWWRDACVRLLGKTHCAVHLRAWGGPDGGYDDARLWRQLHRHA
FT                   SFPVSFSWHAGLGGSLWEGVQNKDEAARREALRRAEARLGPLEEYDEDVDWVEQDDDTS
FT                   YTGAAILPRSDRARADVAERGPLAVAPQLSPDLARSGHTSTLIDELGLMVVVGGMMLVS
FT                   MVAGDNEHPPAPPDFNGGDEGDVKVHAVRLPEMQVVAPDVMNWTSASEARDEEDPMSAK
FT                   EPCEVPASRFRHQTIDASLPLGSRLSWNAFGDDGRGWGADGTDYSKGATLLVHGGYDGI
FT                   SRCFEKVYLLRVARDGSRCLWGDPGAPTNLVNGERMPRVFHHTLTRLRNSPRAISIGGQ
FT                   TDEDQRTQDDLGHGAVHEMNLDTWTWTRRETNGWPARQVGEMDVTLTSRWLHIAALRPP
FT                   RERRVYRNWTQWNRNSYLYAPVPRDTRVRKHSYKEAMAVMSPYMTKLERAQGEQIVIVG
FT                   GYDDSPDSAIGTMEPWVLDVESWTWHRSYWGPDNYESHTPDGEFIQYIPDGRHRAGSCM
FT                   IGQNLLLVHGGMGKSLMFGGINMLDESDSCVLDLSTLTWIHPDQGLHPRDSGLMFDDAW
FT                   QSVRLRSVAGHTLEGMLAFGGCELGFMRQPTPIAKMDFLILGPTPGVGCSRSPRNKLLY
FT                   YAAAPIGKLQRDSWRSLFRTASERVSKYRVRGFHRIVIDGRERRVMLLEHRDGSKGGLV
FT                   SVRHIGNHGSFCDERWSFWYEDSDSDFHSSSASDEDSD"
     atgccgagaa aacgtcccaa aaagaatgcg gacgatgacg gagggtctga tgagtgcccc        60
     ctcctgtcgc tcgcgcacca ggtgatgacc cccatcgcgg cgcacctcga cggagacgac       120
     ctgtccgcgt tggcgcgaac ctgcgtcgcg atgcgtcgcc tctgcgacgg ccctcaagga       180
     cgcatctggt ggcgcgacgc gtgcgtcaga ctcctcggta agacccactg cgcggtgcat       240
     cttcgcgcgt ggggcggacc ggacggggga tacgacgacg cgaggctgtg gcgccaactc       300
     caccgccacg cgagcttccc cgtgagtttc tcgtggcacg cggggctggg cggttcgctg       360
     tgggagggcg ttcagaacaa ggacgaggcg gcgcgacgag aggcgctgcg acgcgcggag       420
     gctcggctcg gacccctcga ggagtacgac gaggacgtcg actgggtcga gcaggatgac       480
     gatacctcgt acaccggcgc ggcgatcctg ccgaggtccg atcgagcgag agccgacgta       540
     gcggaacggg gcccgctggc ggtggcgccg cagctgtcgc ccgatctcgc gcgcagcggg       600
     cacacctcga cgctgatcga tgaactcgga ctgatggtcg tcgtcggggg catgatgctc       660
     gtctcgatgg tggcggggga caacgaacat ccgccggctc cgccagattt caacggcggc       720
     gacgagggcg acgtcaaggt gcacgcggtg agactcccgg agatgcaagt cgtcgcgccg       780
     gacgtcatga actggacgtc cgcgtcggag gctcgcgacg aggaggatcc gatgtcggcg       840
     aaagagccgt gcgaggttcc ggcgtcgagg tttcggcatc agacgatcga cgcgagcctg       900
     ccgctcggca gccgcctgtc ttggaacgcc ttcggagacg acggccgggg ctggggcgcc       960
     gacggtaccg actactccaa gggcgccacg ctcctcgttc acggcggata cgacgggatc      1020
     agccgctgtt tcgagaaggt gtatctcctg cgggtcgcgc gcgatgggtc gcgatgtctg      1080
     tggggtgacc cgggagcgcc gacgaacctc gtgaacgggg aacgaatgcc gcgggtgttc      1140
     caccacacgc tgacccggct gaggaactcg ccgagggcga tatcgatcgg cggacagacc      1200
     gacgaggatc aacggacgca ggatgacctg ggacacggcg cggttcacga gatgaacctc      1260
     gacacgtgga cctggacccg gcgcgagaca aacggatggc cggcgaggca agtcggcgaa      1320
     atggacgtga ctctcaccag ccgttggttg cacatcgccg cgctacgacc gccgcgcgaa      1380
     cgaagggtgt accgaaactg gacgcagtgg aaccgaaatt cgtatttgta tgctcccgtc      1440
     cccagagaca caagagtgag gaaacattcg tacaaggagg ccatggcggt gatgagtcct      1500
     tacatgacga agttggaaag agcgcaaggg gagcagatcg tcatcgtggg agggtacgac      1560
     gattcgccag actcggccat cgggacgatg gagccgtggg tgctcgacgt ggaatcctgg      1620
     acttggcatc gaagctattg ggggccggat aattacgaat cacatacgcc ggatggtgaa      1680
     ttcatacagt acatacccga tggaaggcac cgggcgggtt cctgcatgat tggccaaaac      1740
     ttactgctcg tgcacggcgg catgggtaag tcacttatgt ttggtgggat aaatatgttg      1800
     gatgaatccg attcatgcgt tctcgatctg tcgacgctca cttggatcca ccctgatcaa      1860
     ggtctccacc caagggatag cggcttgatg tttgatgacg cgtggcaatc tgttcgcttg      1920
     cgctcagtcg cgggacacac gctcgaaggt atgctcgcct ttggagggtg cgaacttggt      1980
     ttcatgagac aacccacgcc catcgcgaag atggacttcc tcatactcgg gccgacaccg      2040
     ggcgttggat gttcccggag tcccagaaat aagctattgt actacgcagc agcgccgatt      2100
     ggcaagttac aaagggattc ttggaggagt ttgtttcgga cggcgtcaga gagagtgtct      2160
     aaataccgcg tccgtggatt tcatcgaatc gtcatcgacg ggagggaacg gcgtgtgatg      2220
     ctgctggaac atcgcgatgg atcgaagggc ggcctcgtgt cggttcgcca cataggcaat      2280
     catggcagct tttgcgatga acgctggtcc ttttggtacg aggatagcga ctcagatttc      2340
     cactcatcct cagcatcaga cgaggatagc gattag                                2376
//

If you have problems or comments...

PBIL Back to PBIL home page