(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE276

MICSR_1.PE276        Location/Qualifiers
FT   CDS_pept        complement(550283..551188)
FT                   /codon_start=1
FT                   /gene_family="HOG000034586" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636906"
FT                   /orf_name="MICPUN_79714"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="endonuclease activity"
FT                   /biological_process="DNA repair"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO62160.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004519"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006281"
FT                   /db_xref="HOGENOM:HBG704164"
FT                   /db_xref="InterPro:IPR000097"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="UniParc:UPI000199A5C9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F3"
FT                   /transl_table=1
FT                   /translation="MRWDVTDPPLPPRAPRLDRALHPSKLTVLSWNVNSIRALLDKDPD
FT                   ILDEVAASEDADVVLLQETKLQEKHVPEMDARVLAKYPYRTWNCSTSRLGYSGTAMFLR
FT                   LEPTRAPWHDPFEMDEFEGEGRVVCAELPNVFVVGAYCPNSGEGLARLRARTKEWDPRM
FT                   SAYLSSLQASAGGKPVVYCGDLNVANEPIDLWGNHAANSLASGYTPEERDSFKRLLLGP
FT                   IRDGGAGLVDTFREAHGTDAKAFTYFSYRAGARPRNRGWRIDYALVSESLRGEVHDAFI
FT                   RGDVGGSDHCPIGVVVKLRE"
     atgaggtggg acgtcaccga cccgccgctc ccgccacgag cgccgaggct cgaccgagcg        60
     ctccatccgt ccaaactcac ggtgctctcg tggaacgtca actccattcg cgcgctcctc       120
     gacaaggacc cggatattct cgacgaggtg gccgcgagcg aagacgcgga cgtggtgctg       180
     ctgcaggaga ccaagctgca ggagaagcac gtgccggaga tggacgcgag ggtgttggcc       240
     aagtacccgt acaggacgtg gaactgttcc acttcgcggc tggggtactc ggggacggcg       300
     atgtttctca gactggaacc gacgcgcgcg ccgtggcacg atccgttcga gatggacgag       360
     ttcgaagggg agggccgggt cgtgtgcgcg gagctcccga acgtcttcgt cgtcggcgcg       420
     tactgcccga acagcggcga gggtctggcg cggcttcgcg cgaggacaaa ggagtgggat       480
     ccgaggatgt cggcgtacct gtcgtcgctg caagcctccg ccgggggtaa accggtcgtc       540
     tactgcggcg atctaaacgt ggcgaacgag cccatcgacc tgtggggcaa ccacgccgcg       600
     aactcgctcg cttcggggta cacccccgag gagagggatt cgtttaagcg cttgctgctc       660
     gggcccattc gcgacggggg tgccggattg gtggacacgt ttcgagaggc gcacggaaca       720
     gacgcgaagg cgtttaccta ctttagctac cgcgcggggg cgaggccgag gaacaggggt       780
     tggaggatag actacgcgct ggtgagcgag tctctccgtg gggaggttca cgacgcgttc       840
     atccgcggcg acgtgggcgg gtcggatcac tgccccatcg gcgtcgtcgt caagctgcgg       900
     gagtag                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page