(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE277

MICSR_1.PE277        Location/Qualifiers
FT   CDS_pept        join(552359..553129,553181..553516)
FT                   /codon_start=1
FT                   /gene_family="HOG000030179" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636907"
FT                   /orf_name="MICPUN_97136"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="ACO61729.1"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG560106"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="UniParc:UPI000199A5CA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F4"
FT                   /transl_table=1
FT                   /translation="MGARLPEPTEGPGACKVWEIKTLGRADDERARDMLEKTAWQVQPI
FT                   MRKRGWKVQELCEMKPEQRDRMGDNLNMGQRVRLKLRKNNSGDWFDYDHVVLVMLHELC
FT                   HNDIGPHNAKFFKLLDEITVECEELMAKGIGGSGAGFDAKGQRLGHRGGWGGIETRDPR
FT                   KAAAEAAARRAGYQAAMGPAGGRKLGGGGTGAATQLGPREAAAAAAERRLRAERFAREN
FT                   GLMNDVVVIDDEDDDDGGDGDGAGEGGGMAKTAPARNEGAEVVVLSSPQEPGTRDAGKR
FT                   KRTSGRRADEDDEEEAEKEETDDDDDVVFVQAVPAPRPGVDRPERRWTCSQCTLVNPER
FT                   ATHCGACERWRFGRGAPAASRPTVGVDD"
     atgggcgcgc gccttccaga gcccacggag ggcccggggg cttgcaaggt gtgggagatc        60
     aagaccctgg gtcgcgccga cgatgagcgc gcgagggata tgctggagaa gaccgcgtgg       120
     caggtgcagc ccatcatgcg caagcgcggg tggaaggtcc aggagctctg cgagatgaaa       180
     cccgagcagc gcgacaggat gggcgacaac ctcaacatgg gccagcgcgt ccgtttaaaa       240
     ctgcgcaaga acaacagcgg cgactggttc gactacgacc atgtcgtctt ggtcatgctg       300
     cacgagctgt gccacaacga catcggcccg cacaacgcga aattcttcaa gctcctcgac       360
     gagatcaccg tcgagtgcga ggagctcatg gccaagggaa tcggcggaag cggcgcgggg       420
     ttcgacgcga agggtcagag actggggcac aggggcgggt ggggcggaat cgagacgcga       480
     gatccgcgaa aggccgccgc ggaggcggcg gcgaggcgcg cggggtacca ggccgccatg       540
     ggacccgcgg ggggcagaaa actgggcggg ggggggaccg gcgccgcgac ccagctgggc       600
     ccgagggagg cggcggccgc cgccgcggag cgcagacttc gcgcggagcg attcgcgagg       660
     gagaacggct tgatgaacga cgtcgtggtc atcgacgacg aagacgacga cgacgggggg       720
     gacggggacg gggcaggcga aggaggaggg atggcaaaga cggcgccagc taggaacgag       780
     ggtgccgagg tggtggtgtt gtcgagtccg caggagccgg gaacccggga cgcggggaaa       840
     cggaagagaa cttcggggcg acgagcggac gaagacgacg aggaggaggc ggaaaaggag       900
     gaaacagacg acgacgacga cgtcgtgttt gtccaggcgg tgcccgcgcc ccgcccgggt       960
     gtcgaccgac cggagcgcag gtggacgtgc tcgcagtgca cgctggtgaa cccggaacgc      1020
     gcgacgcact gcggcgcgtg cgagcggtgg aggttcgggc gaggcgcgcc cgcagcgtcc      1080
     agaccaaccg taggcgtcga cgactga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page