(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE278

MICSR_1.PE278        Location/Qualifiers
FT   CDS_pept        join(complement(554616..554744),complement(553601..554533))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636908"
FT                   /orf_name="MICPUN_56854"
FT                   /product="Predicted protein"
FT                   /function="methyltransferase activity"
FT                   /biological_process="rRNA processing"
FT                   /protein_id="ACO62161.1"
FT                   /db_xref="GO:0006364"
FT                   /db_xref="GO:0008168"
FT                   /db_xref="HOGENOM:HBG611222"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="UniParc:UPI000199A5CB"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F5"
FT                   /transl_table=1
FT                   /translation="MRAAPARVGPPVRVARGPRRAAGRRSIRGVRVECRNRILFRREVD
FT                   ESDDGAESITLALGDSRSEHVRGVLKLAAGDSLRVGVVNGSPATAVVSTMDATSMTLTW
FT                   RPGVETDDGDTARRSLTAPLVDVDLLLAMPRPKVMTRLWAPLASIGVRNVYLTNASRVE
FT                   RYYWDSTALDEAKVIAELTRGMEQSGDVRMPGVCVVRRFPAAVDAVREMTGAPRRDGGQ
FT                   EPRGRGGREGGGNGGGMPREGSAFWLVKPPPADENDDDAEVVMLTAHPGAAATVGDAFG
FT                   DLSSSSSSSSSGRPRRTRAVVAVGPEGGWTDFERRSLLDAGFVEVALGRRTFATDVACV
FT                   ALVAAVRERTSSW"
     atgcgcgccg caccggcgag ggtgggaccg cccgtgcgcg tcgcgcgcgg gccccgacgc        60
     gcggcggggc gtcgctcgat acgcggcgtg agggtagagt gcagaaaccg catcctgttc       120
     cgccgagagg ttgacgagag cgacgacggc gccgagtcca tcacgctcgc cctcggggac       180
     tccagatccg agcacgtccg cggggtcctc aagctcgccg cgggcgactc gctccgcgtc       240
     ggcgtcgtca acggatcccc cgccaccgcc gtcgtctcga ccatggacgc gacgtccatg       300
     acgctcacct ggcgcccggg cgtcgagacc gatgatggag acaccgcgcg ccgcagcctg       360
     acggcgccgc tcgtggatgt ggacctcctg ctggcgatgc ccagacccaa ggtgatgacc       420
     cggctctggg cgccgctcgc gtccatcggg gtgcgaaacg tgtacctcac caacgcgtcc       480
     cgtgtggaga ggtactactg ggacagcacg gcgctggacg aggcgaaagt tattgcagag       540
     ctgacgcggg ggatggagca gagcggcgac gtgcgcatgc ccggggtgtg cgtcgtgcgg       600
     cggttcccgg ccgcggtgga cgccgtgcgc gagatgaccg gcgcgccgcg gcgggacggg       660
     ggacaggaac cgagggggcg gggggggcga gagggtgggg ggaacggcgg cgggatgccg       720
     agggagggga gcgccttctg gctcgtgaaa cccccgcccg ccgacgaaaa cgacgacgac       780
     gcggaggtcg tgatgctcac cgcgcatccg ggcgcggccg cgaccgtcgg tgacgcgttc       840
     ggtgacttgt cctcatcctc ctcctcctcc tcctcggggc gtcctcggcg gacccgcgcg       900
     gtcgtcgccg tcgggccgga aggcggttgg accgactttg agcggcgttc gttgctcgac       960
     gccgggtttg tcgaggtggc gctgggaagg cgcacgttcg cgacggacgt ggcgtgcgtc      1020
     gcgctcgtcg ccgcggtgag ggaacgcacg agttcgtggt ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page