(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE279

MICSR_1.PE279        Location/Qualifiers
FT   CDS_pept        554850..557468
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636909"
FT                   /orf_name="MICPUN_99408"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61730.1"
FT                   /db_xref="InterPro:IPR021622"
FT                   /db_xref="UniParc:UPI000199A5CC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F6"
FT                   /transl_table=1
FT                   /translation="MEPRGEAIGGTPPQRSERRFGVLGPQRIDRDGVGFASHENLAEVV
FT                   PYLNRSLNDLGYPGPLELEAPSVGDLARVANVLFLILRDRQQDAASREQWGRERRRLAA
FT                   DKARAETFYERARAELAAKDEELANSLAKSDGRVDKERRRLDDATAECASLKQRLLKSQ
FT                   QRCATLENESRRREKEREKLSARLEKFVNDRRRDVANATPVGVMRVTTGGPDDVGPAVE
FT                   QKVSFGGLNAANATSRVPNVHATGRHKTVAAAAATSKAAALDAAARVAASLASPFVSQE
FT                   LHHQMMGAYEAKMRSLMHDVNDLRELLAANGVDPETGERIGDPERRQTAGGYLPSPAEA
FT                   RGDLGGAGPDAMASGAMALGDVEDETAAAARDAALIAAATEAEIGVGDDAFTFNLGALR
FT                   RRLGDDGSARSPPRGFGATTTTTTTRASTERLPTAPPAALASGRAAPNETQPAGALASG
FT                   GSAGSVPSAGAPSPIEVALAWHEREHARLRGVLSHPPRELRDAPTPELAFEVEKTILSP
FT                   AKSAASGGGGGVAAAREDLRGAVAAARAAAAKASPARQQLHWNEPPSPARAPAPIYESS
FT                   PSVSSAEEDDDAPTPRTTPPTPAFGAAASRAYDNPMADDAADLDGEELAREAAAAAAER
FT                   EAEAAAAVFAERVDRAFNSVQHEASRGSIDDAGEDLVELDVGLMADDDDDVYVADDDSH
FT                   VQRVQREAAGTPTGRVTVEPRSDTIAAFVDGSRRLPEFEGVGERDRGGAFGSPADVPAD
FT                   RTTGRPEAGVSAGAGAGADFGARMAQLSTPRAQPPAPAAVAPPSPAPPASPLDELLARH
FT                   LKLGRGRPTAGGGEGDAKEDWRERYRRRRANPFASFAANDAKLAVDASQQTPGFAMLHS
FT                   G"
     atggagccgc gaggggaggc catcgggggc accccgcccc agcgatccga gcgtcgcttc        60
     ggcgtcctgg ggccccagag aatagaccgc gacggcgtcg gcttcgcgtc gcacgagaac       120
     ctcgcggagg tggtgcccta cctcaacagg tccttaaacg acctcgggta tcccggcccg       180
     ctggagctgg aggcgcccag cgtcggggat ctggcgcgcg tcgccaacgt cctcttcctc       240
     atcctccgcg acaggcagca ggacgcggcc agccgcgagc agtggggcag ggagcggcgg       300
     cggctcgcgg cggacaaggc ccgcgcggag accttctacg agcgcgcgcg cgcggagctc       360
     gccgcgaagg atgaggagct ggcgaattcc ttggccaagt ccgacgggcg ggtggacaag       420
     gaacggagga ggctcgacga cgcgaccgcg gagtgcgcca gcctgaagca acggctgctc       480
     aaatcccagc agaggtgcgc cacgctggag aacgagtcgc gacggcggga gaaggagcgc       540
     gagaagctca gcgcgaggct cgagaaattc gtcaacgatc ggcgcaggga cgtcgcgaac       600
     gcgactcccg tcggggtcat gcgcgtcacc acgggcgggc ccgacgacgt ggggcccgcc       660
     gtcgaacaga aggtctcatt cggcggcttg aacgccgcga acgccacgtc ccgcgtcccg       720
     aacgtgcacg ccacggggcg gcacaagacc gtcgccgccg ccgcagccac gtccaaagcc       780
     gcggcgctcg acgccgcggc tcgcgtcgcg gcttcgctgg cgtcgccgtt cgtcagccag       840
     gagctgcacc accagatgat gggcgcgtac gaggcgaaga tgcggtcgct gatgcacgac       900
     gtgaacgacc ttcgcgagct cctcgccgcc aacggcgtcg atccggagac gggggaacgg       960
     atcggagacc ccgagcgacg acaaaccgcg ggaggctatc ttccatcgcc cgcggaggcg      1020
     cgcggggatc tcgggggtgc gggacccgac gcgatggcgt cgggcgcgat ggcgctgggt      1080
     gacgttgagg acgagacggc ggcggcggcg cgcgacgccg cgctcatagc ggcggcgacg      1140
     gaggcggaga ttggcgtcgg cgacgacgcg tttactttca acctaggcgc gctgcgacgg      1200
     aggctcgggg atgatggatc ggcgcggtcg ccgccgcggg ggttcggggc gacgacgacg      1260
     acgacgacga cgcgagcgtc cacggagcgg ctgcccacgg cgccgccggc cgcgctcgcg      1320
     tccggccgcg cggcgccgaa cgagacacag ccggcgggtg ccctcgcgtc cggcgggtcg      1380
     gcggggtccg tcccgtccgc gggggccccg tcgcccatcg aggtggcgtt ggcttggcac      1440
     gagcgcgagc acgcgaggct ccgcggcgtc ctgtcccacc cgccgaggga gctccgcgac      1500
     gcgcccacgc ccgagctggc gttcgaggtt gagaagacca tcctatcccc cgccaagtcg      1560
     gcggcgagcg gcggcggcgg cggcgtcgcg gcggcgaggg aggacctgcg cggggcggtg      1620
     gcggcggcga gggcggcggc ggcgaaggcg tcccccgcga ggcagcagct ccactggaac      1680
     gagccgccgt cgcccgcgcg cgcgcccgcc cccatctacg agtcaagccc atcggtttcc      1740
     tcagccgagg aggacgacga cgctccgacg ccgaggacga cgccgccgac gcccgcgttc      1800
     ggcgccgcgg cgtcgcgcgc gtacgacaat cccatggcgg acgacgccgc agacctcgac      1860
     ggggaggagc tcgcgcggga ggcggcggcg gcggcggcgg agcgcgaggc tgaggcggcg      1920
     gcggcggttt tcgccgagcg ggtcgatcga gcgttcaaca gcgttcaaca cgaggcgtcg      1980
     cgcgggtcga tcgacgacgc gggcgaggac ctcgtcgagc tcgacgtggg tctcatggcg      2040
     gacgacgacg acgacgtgta cgtggcggac gacgattcgc acgttcaacg cgttcaacgc      2100
     gaggcggccg ggaccccgac ggggcgagtg acggtggagc cgaggtcgga cacgatcgcg      2160
     gcgttcgtgg acggttccag gcggcttcca gaattcgaag gagtcgggga gagggaccgc      2220
     ggcggcgcgt tcggttcccc cgcggacgtc cctgccgatc gaaccacggg acgtccggaa      2280
     gccggggtgt cggccggggc tggggctggg gcggatttcg gcgcgaggat ggcacagctg      2340
     tcgacgccgc gggcccagcc gcccgccccg gcggccgtcg cccccccctc gcccgcgccg      2400
     cccgcgtcac cgctggacga gctcctcgcg cggcacctca aactgggtcg cggcaggccc      2460
     accgcgggcg gcggggaggg cgacgcaaag gaggattgga gggaacgtta caggcgccgg      2520
     cgagccaacc cgttcgcgtc cttcgctgcg aacgacgcca agctggcggt ggacgcgtcg      2580
     cagcagacgc cggggttcgc gatgctgcac agcggatga                             2619
//

If you have problems or comments...

PBIL Back to PBIL home page