(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE28

MICSR_1.PE28         Location/Qualifiers
FT   CDS_pept        complement(48814..49737)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636033"
FT                   /orf_name="MICPUN_56600"
FT                   /product="Predicted protein"
FT                   /function="calcium ion binding"
FT                   /protein_id="ACO62043.1"
FT                   /db_xref="GO:0005509"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR018249"
FT                   /db_xref="UniParc:UPI000199AABE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q5"
FT                   /transl_table=1
FT                   /translation="MEGAPIDEAPASGQEPVGAPHEENPPHNDDNPVTKLFKDMGTKVK
FT                   NVVAAVERMEEEVIDDKTVNDKVKAIQHTRNVKTLRQMWIDLILSKEFTTIIDQVFDKC
FT                   CKLNDDDGDGHEGDGKLDRTELGAAMTMLWERLDQKTGGGKKLPRIKESEETVLRRYDA
FT                   DSDGHLDRDEFHGFARTYFSRVEWSSWRVACHGATKGFGFYVAQRMLLQPAIGMVKTAV
FT                   GPIVKAKIQKALESGAASVLRGSLRKVKYAVKRPLAKTNNAEGKAILEEELMEMRAKAR
FT                   AKLVALVKSVAICCVGGSVGAVAGWL"
     atggagggcg ccccgatcga cgaggcaccc gcgtcgggtc aggagcccgt cggggctccg        60
     catgaagaaa acccacccca caacgacgac aaccccgtga caaaactgtt caaggacatg       120
     ggcaccaagg tcaagaacgt ggtcgccgct gttgagcgga tggaagagga ggtgatagac       180
     gacaagacag tgaacgacaa ggttaaggcg atacagcaca cgaggaacgt caagaccctg       240
     cgccagatgt ggatcgacct catcctctcg aaggagttta ccaccatcat cgatcaggtg       300
     ttcgacaagt gctgtaagct caacgacgat gacggggacg ggcacgaagg ggacggcaag       360
     ttggacagaa cagagcttgg ggccgctatg acgatgttgt gggaacggct ggaccagaag       420
     acgggcggtg gcaagaagct gccaaggata aaggaaagcg aggagactgt actgaggcgg       480
     tacgacgccg acagtgacgg ccacttggac agggacgaat tccacgggtt cgccaggacg       540
     tacttcagtc gggtggagtg gagttcttgg agagttgcat gccacggtgc caccaagggg       600
     ttcgggttct acgtcgcaca gaggatgctg ctacaacccg cgatcgggat ggtaaagacg       660
     gcggtggggc ccatcgtcaa ggccaagatt cagaaggcgc tggagagtgg cgcggcgtcg       720
     gtgctgcggg ggtcgttgcg gaaggtcaag tacgcggtca agcggcctct cgcaaagaca       780
     aacaacgcgg agggaaaggc gatactggag gaggagttga tggagatgag ggccaaggca       840
     cgggccaagc tggtcgcctt agtcaagagc gtcgctattt gctgcgtggg cggcagcgtg       900
     ggcgcggtag cgggatggct gtag                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page