(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE280

MICSR_1.PE280        Location/Qualifiers
FT   CDS_pept        557675..558502
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636910"
FT                   /orf_name="MICPUN_56856"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61731.1"
FT                   /db_xref="HOGENOM:HBG609227"
FT                   /db_xref="UniParc:UPI000199A5CD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F7"
FT                   /transl_table=1
FT                   /translation="MAAIYASRVMPRSGAAAARSPRRSRLSPGPRLIASPRRQISSRSG
FT                   GSDSSGGVGESARDAALRMEQEALDARTAIRLASLRAQKDEERAIQQRAVELQKEMAIR
FT                   EEGRRRAEETGGRRPTQRKAVPIFIAGVQCTAMSLASLTLTNRAAAFLVDGDVPVANRT
FT                   LLVNLSVGGGVAVTATLIISTLILFTVAIKEGLGVINNTPVTFYRCDGQGPTCCKNGPH
FT                   NLGYAAKFTYLANGRGFETRQRDSMRRHLLVSRKCRELKPIVIYPKEEGWKLW"
     atggcggcaa tctacgcatc acgggtgatg ccgcgctcgg gggcggccgc cgcgcgatcg        60
     ccgcgccgtt cgcgactctc ccctggtccc cggctcattg cgagtccgcg tcggcaaata       120
     tcttcacgat ccggcgggag cgattcgtcc gggggcgtgg gcgagtccgc gcgcgacgcg       180
     gcgctccgca tggagcagga ggcgctcgat gcgcgcaccg cgatccgtct cgcgtccctg       240
     cgcgcgcaaa aggacgagga acgcgccatt caacagcgcg ccgtcgagct ccagaaggag       300
     atggcgataa gagaagaggg ccggcgcaga gccgaggaga cgggcggaag gcgaccgacg       360
     cagaggaagg ccgtgcccat attcatcgcg ggcgttcagt gcaccgcgat gtccttagcg       420
     tccctgacgc tgaccaacag ggcggccgcc tttctcgtcg acggggacgt cccggtggcc       480
     aacaggacgc tcctcgtcaa cctcagcgtc ggcggcggcg tcgcggtgac cgccacgctg       540
     atcatatcca ccctgatcct cttcaccgtg gcgataaagg agggcctcgg cgtgatcaac       600
     aacaccccgg tgacgttcta caggtgcgac gggcaaggac ccacgtgctg caagaacggt       660
     ccgcacaacc tcgggtacgc ggctaagttc acgtacctcg cgaacggccg ggggttcgag       720
     acgaggcagc gggactccat gcgcaggcac ctcctcgtga gccgcaagtg cagggagctg       780
     aaaccgatcg tgatctaccc gaaggaggag ggctggaagc tctggtga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page