(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE281

MICSR_1.PE281        Location/Qualifiers
FT   CDS_pept        join(complement(559115..559588),complement(558650..558991))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636911"
FT                   /orf_name="MICPUN_107900"
FT                   /product="Predicted protein"
FT                   /biological_process="ubiquitin-dependent protein catabolic
FT                   process"
FT                   /protein_id="ACO62162.1"
FT                   /db_xref="GO:0006511"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="UniParc:UPI000199A5CE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F8"
FT                   /transl_table=1
FT                   /translation="MRRLGASSAYTAVPTDLHSEGAEGAEGAEESPAESPAESPADDAP
FT                   TDVSLDVKLSFRRLPKGTWVKLQPRSADFQGELATDNSVDLRELLEATLHRRCALTVGD
FT                   DVSVRAHGDREYALRVVEVLPDDADGAVSLVETDVEVDIAPSEDYEDAMRRLAEAAAAA
FT                   RAERYRAAVSERLPVEPDADAAGGCVPCRFQLPDGRTVTRRFAPTDPLAAVFDYVISAG
FT                   GAGEGEAFRLVTRWPRTVTELDDGARTVRAAGLKPADTLFVEKLEKTAA"
     atgcgacggt tgggcgcgtc atccgcctac acagctgtgc cgacagacct acacagcgag        60
     ggtgccgagg gtgccgaggg tgccgaggag tcccccgcgg agtcccccgc ggagtccccc       120
     gcggatgatg cccccaccga cgtctcgctc gacgtcaagc tctcgttccg ccggctgccc       180
     aaggggacgt gggtcaagct ccagcccagg tcagccgact ttcaaggcga actcgcgacg       240
     gataactcgg tggacctccg ggagttactg gaggcgacgc tacaccgccg ctgcgcgctg       300
     acggtgggcg acgacgtctc cgtccgcgcg cacggcgatc gcgagtacgc cctacgggtc       360
     gtggaggttt tgcccgacga cgccgacgga gcggtgagtc tcgtggaaac ggacgtcgag       420
     gttgacatcg ctccgagcga ggattacgaa gacgcgatgc gacgcctcgc ggaggcggcg       480
     gcggcggcga gggcggagag gtatcgagcc gcggtgtcgg agaggctccc ggtggagccc       540
     gacgcggacg cggcgggcgg ttgcgtgccg tgcaggttcc agctccccga cggtcggacg       600
     gtgacgcgtc gtttcgcgcc gacggatccg ttggcggcgg tgttcgacta cgtgatatcg       660
     gcgggtggcg ccggcgaggg cgaggcgttt cggctggtca cccggtggcc gcggacggtg       720
     acggagctcg acgacggagc tcggacggtg cgtgccgcgg gtcttaagcc cgcggacacc       780
     ctgttcgtgg agaagctgga gaagaccgcc gcttga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page