(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE282

MICSR_1.PE282        Location/Qualifiers
FT   CDS_pept        <560601..>560996
FT                   /codon_start=1
FT                   /gene_family="HOG000264651" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636912"
FT                   /orf_name="MICPUN_72902"
FT                   /product="Mitochondrial protein translocase family "
FT                   /protein_id="ACO61732.1"
FT                   /db_xref="HOGENOM:HBG593865"
FT                   /db_xref="InterPro:IPR013261"
FT                   /db_xref="UniParc:UPI000199A5CF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F9"
FT                   /transl_table=1
FT                   /translation="IPEKPVSAVEAGGYGIVIAAALAVALGAIWFSFKELIFEPKEQTV
FT                   FNRALDKIAVDPRVTVRVGTPMTGYGREGRSRSARQHVPHVVHVDGAGREHVRIQGAVR
FT                   GPQGKATVHADAYKGDSGEWEFAYLLVD"
     atcccggaga aacccgtgag cgccgttgag gcgggcggct acggcatcgt catcgccgcc        60
     gccctcgccg tcgccctcgg cgccatctgg ttctcgttca aggagctcat cttcgaaccc       120
     aaggaacaga cggtgttcaa cagggcgctc gacaagatcg ccgtggaccc gcgagtgacg       180
     gtgcgcgtgg gcacgccgat gacgggatac ggccgcgagg gacggagcag gagcgccagg       240
     cagcacgtgc cccacgtcgt ccacgtggac ggtgcgggac gcgagcacgt gaggatccag       300
     ggcgccgtga gggggccgca gggtaaggcg acggtgcacg cggatgcgta caagggcgac       360
     agcggcgagt gggagtttgc gtacctgctg gtggac                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page