(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE283

MICSR_1.PE283        Location/Qualifiers
FT   CDS_pept        561239..562222
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636913"
FT                   /orf_name="MICPUN_56859"
FT                   /product="Predicted protein"
FT                   /function="RNA binding"
FT                   /function="pseudouridine synthase activity"
FT                   /biological_process="pseudouridine synthesis"
FT                   /protein_id="ACO61733.1"
FT                   /db_xref="GO:0001522"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0009982"
FT                   /db_xref="HOGENOM:HBG750656"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniParc:UPI000199A5D0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G0"
FT                   /transl_table=1
FT                   /translation="MLVARRWWSRIDVCAHAPRAASAVSWVLHRDADVLVVDKPAGVPM
FT                   RSVHGVKGVDAFLADLRFDLAHPPMTVHRLDRDTTGCLILARTREAQRTLAGYFQDRAR
FT                   VARRGSGRSTKTTSPESLGDVRRVYWALVSATSTLASRGTIDAALVTTHAGVTLKPGAG
FT                   AKPAATDYEVISRASPDSCAPTAAGRVPAVLALVPRTGRKHQLRVHCAGALDAAIVGDY
FT                   KYGYRDVSRTGGVADDWRRVLRDIDERSTRRLNDAGTADGEVRGAGVPLHLHARCVEFT
FT                   HPSSGERVRVVAPAPSHMSLACEALGLALDGGDDDGLGLLLHFNRR"
     atgctcgtcg ctcggaggtg gtggtcgcgg atcgacgtct gcgcgcacgc cccgcgagct        60
     gcgtcggctg tttcgtgggt gcttcaccgg gacgccgacg tcctcgtcgt ggacaagccc       120
     gcgggggtgc ccatgcgttc cgtacatggc gtcaaggggg tcgacgcctt cctcgccgac       180
     ctcaggttcg atctcgcgca tcccccgatg acggtccaca ggctcgacag ggacaccacc       240
     gggtgcctga tactcgcgag gacccgcgag gcgcagagga cgctcgcggg gtacttccag       300
     gaccgagccc gagtcgcccg tcgcggatcg ggccgatcga cgaaaacgac gagcccagag       360
     agcctcggcg acgtccgacg cgtgtactgg gcgctggtgt ccgctacatc gaccctggcg       420
     tcgcgcggga cgatcgacgc ggcgctcgtc accacgcacg cgggcgtcac cctcaaaccg       480
     ggcgcgggcg ccaagccggc ggcgacggac tacgaggtca tctcgcgagc atcccccgac       540
     agctgtgcgc ccaccgcggc gggtcgcgtt cccgccgtgc tcgctctcgt tccccgcacg       600
     ggccggaagc accagctgag ggtgcactgc gcgggggcgc tggacgcggc gatcgtgggc       660
     gactacaagt acgggtacag ggacgtgagc aggacgggcg gcgtcgcgga cgattggagg       720
     cgagtgctgc gcgacatcga cgagaggagc actcgacgat tgaatgacgc gggaacggcg       780
     gatggggaag ttcgcggggc gggcgttccg ctgcacctgc acgcgaggtg cgtggagttc       840
     acgcatccgt cgagcgggga gcgcgtgcgg gtggtcgcgc cggcgccgtc gcacatgtcg       900
     ctggcgtgcg aggcgctcgg cttggctctg gacggcggcg acgacgacgg gttgggactt       960
     ttattacatt tcaatcgtcg gtga                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page