(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE284

MICSR_1.PE284        Location/Qualifiers
FT   CDS_pept        562307..564067
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636914"
FT                   /orf_name="MICPUN_56860"
FT                   /product="Predicted protein"
FT                   /function="L-ascorbic acid binding"
FT                   /function="iron ion binding"
FT                   /function="oxidoreductase activity, acting on paired
FT                   donors, with incorporation or reduction of molecular oxygen"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="ACO61734.1"
FT                   /db_xref="GO:0005506"
FT                   /db_xref="GO:0016705"
FT                   /db_xref="GO:0031418"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniParc:UPI000199A5D1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G1"
FT                   /transl_table=1
FT                   /translation="MTAGEERPVVVKTRWVSAEEDEPSAPPRGNATAEERPSGGCFEAE
FT                   VSLPGVTSAESIVAEIVTAAEAGAPPSLYVRAKADGGGGASLSADVPLPDGCDHREISA
FT                   VKWSRKRSTLRVRFAASSPAAAGGAEDDGDDEDGAGPLAEYLRMLGVRDGEAGGSEPEL
FT                   EEDGDPRDGVRDPAGEKRENPSRADGKTPQPTEPTKQTPPGRAVRASGNKKKRRKNAAG
FT                   RGVAATPGRQLETPGRQLETTRPGVSLSELSDDLAAQLHARGFAHAQFITRDAVCVVRD
FT                   EIKRVAPLYTDGEIWLGKHDAGAQIAVKSVRGDRVFWMDPATADGGRFDAMRSMLRAID
FT                   ELVLDHLARACPKRLGGLADRTHAMLAEYPGRGSRFVRHVDNTGRDGRRLTVLCYLNPD
FT                   YAGEHGGALKVYDADDADGSRGVEVAPAAGTIAMFYADETPHEVLPSARSRHSFTVWYY
FT                   DETEFKDAETRRGEAAAADSRAAHMPSVDGSGGSDPGATLAALDASDREAQAFVRRMMT
FT                   QRLTPAGAAAAARGLGERALRTVATVFGAPDPASFVVALTQMSQSDLDELRMEITSMGM
FT                   DNAPDAELVA"
     atgaccgccg gcgaggaacg ccccgtcgtc gtgaagaccc gctgggtgag cgccgaggaa        60
     gacgagccca gcgcgccgcc gcgcgggaac gcgaccgcgg aggaacgccc gtcgggagga       120
     tgcttcgagg cggaggtgtc gcttccgggg gtgacgagcg ccgagagcat cgtcgccgag       180
     attgtgacgg cggcggaggc gggcgcgcca ccgtctctgt acgtgcgcgc gaaggccgac       240
     ggcggcggcg gcgcgtccct ctccgcggac gtgcctctgc ccgacgggtg cgaccaccgc       300
     gagatcagcg cggtcaaatg gagcaggaag cgctcgacgc tgcgcgtgcg gttcgcggcg       360
     tcgagtccgg cggcggccgg cggcgcggag gatgacgggg acgacgagga tggcgccgga       420
     ccccttgcgg agtaccttcg gatgctggga gtgcgcgacg gcgaggcggg agggtcggag       480
     ccggagctcg aggaggatgg cgacccacgt gacggggtgc gcgatccggc gggtgaaaaa       540
     cgcgagaacc catcgagggc tgacgggaaa accccgcaac cgacggaacc gacgaaacag       600
     acgccgcccg ggcgcgccgt cagggcgtcc gggaacaaga agaagcgccg caagaacgcc       660
     gccggtcggg gcgtcgccgc gacgcccggc cgacagctgg aaactcccgg ccgacagctg       720
     gagactaccc gccccggcgt ctccctctcc gaactctccg acgacctcgc ggcgcaactc       780
     cacgcgcggg ggttcgcgca cgcgcagttc atcacccgcg acgccgtgtg cgtcgtgcgc       840
     gatgagatca agcgcgtcgc gcccctgtac accgacgggg agatctggct cggtaagcac       900
     gacgccgggg cgcagatcgc ggtcaagtct gttcgcggcg atcgggtgtt ttggatggac       960
     ccggccaccg ccgacggcgg ccgattcgac gccatgcgtt cgatgcttcg cgccatcgac      1020
     gagttggtgt tggaccacct cgcacgcgcc tgtcccaaac ggctcggggg tctcgcggac      1080
     cgcacgcacg cgatgctcgc cgagtacccc ggccgaggtt cacgtttcgt tcgacacgtg      1140
     gacaacaccg gacgcgacgg ccggcggctc accgtgctgt gctacctcaa ccccgactac      1200
     gccggcgagc acggcggggc gctgaaggtg tacgacgcgg acgacgcgga cgggtcgcgg      1260
     ggcgtggagg tggcgcccgc ggctgggacg atcgcgatgt tctacgcgga cgagacgccc      1320
     cacgaggtgc tgccgagcgc gcgaagtcgg cactcgttca cggtttggta ttacgacgaa      1380
     acagagttta aggatgcgga gacgcggcgc ggcgaggcgg ccgccgcgga ctcgcgcgcg      1440
     gcgcacatgc ccagcgtgga cgggtcgggt gggtccgatc ccggcgcgac gctcgcggcg      1500
     ctcgacgcga gcgatcggga ggcgcaggcg tttgtgcgga ggatgatgac gcagcggctg      1560
     acgccggcgg gggcggcggc ggcggcgagg ggtctcggcg aacgggcgct gcggacggtg      1620
     gcgacggtgt tcggggcgcc ggatccggcg tcgttcgtcg tggcgctgac gcagatgtcg      1680
     cagagcgatc tggacgagtt gcggatggag atcacgagca tgggaatgga caacgcccca      1740
     gacgccgagc tcgtggcgtg a                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page