(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE286

MICSR_1.PE286        Location/Qualifiers
FT   CDS_pept        complement(565542..565943)
FT                   /codon_start=1
FT                   /gene_family="HOG000232198" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636916"
FT                   /orf_name="MICPUN_99413"
FT                   /product="Predicted protein"
FT                   /biological_process="cell adhesion"
FT                   /protein_id="ACO62163.1"
FT                   /db_xref="GO:0007155"
FT                   /db_xref="HOGENOM:HBG560112"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniParc:UPI000199A5D3"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G3"
FT                   /transl_table=1
FT                   /translation="MTDMASPGAGASVVMATCSDERHPPHNALDEDERSFWVTTGLFPQ
FT                   EIVVKLGKTSQVTKVRTLTANVRKFSLEYCDDDEPIGFKPAFEVELGDKGPARLQTEVH
FT                   QVNCRAKFLKFVIGSGWGDFASVHRISVF"
     atgacggaca tggcgagccc cggcgcgggc gcgtcggtgg tgatggcgac gtgctccgac        60
     gagaggcacc cgccgcacaa cgccctcgac gaggacgagc ggagcttctg ggtgacgacc       120
     ggacttttcc ctcaggagat cgtggtgaag ctcgggaaga cgtcgcaggt gaccaaggtg       180
     cggacgctca cggcgaacgt gcggaagttc tcgctggagt actgcgacga cgacgaaccc       240
     atcgggttca agcccgcgtt cgaggtggag ctcggggata agggaccggc gcggctgcag       300
     acggaggtgc accaagtgaa ctgcagggcc aagtttctca agttcgtcat cggcagcggc       360
     tggggcgact tcgcgagcgt gcacaggata tcggtgtttt aa                          402
//

If you have problems or comments...

PBIL Back to PBIL home page