(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE287

MICSR_1.PE287        Location/Qualifiers
FT   CDS_pept        566677..567828
FT                   /codon_start=1
FT                   /gene_family="HOG000116557" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636917"
FT                   /orf_name="MICPUN_79944"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61736.1"
FT                   /db_xref="HOGENOM:HBG755340"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="UniParc:UPI000199A5D4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G4"
FT                   /transl_table=1
FT                   /translation="MENNGRVVELELKEFGLTGAVPAELGRLSALMDLNLGGNQLTLLP
FT                   AEIGQLASLESLELGYNELTSVPVEIWQLASLEGLYLGGNQLTSVPAEIGQLTSLEDLS
FT                   LEANRLTSVPTEIGQLTSLTQLDLRDNQLTSVPAEIWRLTSLTYLNLNDNQLTSVPAEI
FT                   RQLTSLRELWLSANHLTSVPAEIWQLAALVKLSVTENQLTSVPAEIWQLTSLTELYLHG
FT                   NQLTSVPAEIGQLTSLTALSLYDNQLTSVPAEIGQIRSLVKLSLHGNRLTSLPAEIGQL
FT                   RALVEFELDRNLLTSVPAEIGHLTSLTELSLHGNQLTSVPSEIGQLTSLGELSLSGNQL
FT                   TSVPAAMRELEAAGCYMDLDLDSDPEPEPEEEEGEPLDFDLFD"
     atggaaaaca acggcagggt ggtggagctc gagttgaaag agtttggcct gaccggagcg        60
     gtgccagctg agcttgggcg cctgagcgcg ctgatggatt tgaacctcgg cggcaatcag       120
     ctgacgctct tgccggcgga gatcgggcag ctcgcgtctc tggagagttt ggagcttggc       180
     tacaatgagc tgacgagcgt gccggtggag atttggcagc tcgcgtcgct tgaggggttg       240
     tacctcggcg gcaatcagtt gacgagcgtg ccggcggaga tcgggcagct cacgtcgctg       300
     gaggatttga gcctcgaagc caatcggctg acgagcgtgc cgacggagat cgggcagctc       360
     acgtcgctga cgcagttgga cctccgcgac aatcagctga cgagcgtacc cgcggagatc       420
     tggcggctca cgtcgctcac gtatttgaac ctcaacgaca atcagctgac gagcgtgcca       480
     gcggagatca ggcagctcac gtcgctgcgg gagttgtggc tcagcgccaa tcacctgacg       540
     agcgtgccgg cggagatttg gcagctcgcg gcgctggtga agctgagcgt caccgaaaat       600
     cagctgacga gcgtgccggc ggagatttgg cagctcacgt cgctgacgga gttgtacctc       660
     cacggcaatc agctgacgag cgtgccggcg gagatcgggc agctcacgtc gctgacagcg       720
     ttgtcactct acgacaatca gctgacgagc gtgccggcgg agatcgggca gatcaggtcg       780
     ctggtgaagc tgagcctcca cggcaatcgg ctgacgagct tgccggcgga gatcgggcag       840
     ctcagggcgc tggtggagtt tgagctcgac cgcaatctgc tgacgagcgt gccggcggag       900
     atcggccacc tcacgtcgct gacggagctg tccctccacg gcaatcagct gacgagcgtg       960
     ccgtcggaga tcgggcagct cacgtcgctt ggggagttga gcctcagcgg caatcagctg      1020
     acgagcgtgc cggccgcaat gcgcgagctt gaagcggcag gctgctatat ggatctggat      1080
     ctggacagtg atcctgagcc cgagcccgag gaggaggagg gggagccctt ggacttcgac      1140
     ctcttcgatt aa                                                          1152
//

If you have problems or comments...

PBIL Back to PBIL home page