(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE289

MICSR_1.PE289        Location/Qualifiers
FT   CDS_pept        join(complement(570206..>570538),
FT                   complement(<569675..570145))
FT                   /codon_start=1
FT                   /gene_family="HOG000198014" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636919"
FT                   /orf_name="MICPUN_71782"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /biological_process="RNA metabolic process"
FT                   /protein_id="ACO62164.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016070"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI000199A5D6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G6"
FT                   /transl_table=1
FT                   /translation="RAFKSILNKLTPQNFEKLLEQVLAEGIDEAQTLIGLIGQLFDKAL
FT                   TEPTFAELYAMMCQQLSNRFLAENIEFVDPDCDPDAEGGPRMINFKRVLLNKCQEEFEK
FT                   GDSAIKAEEKEEGEVPAKPKTPEELELDERRKIQQREDRMRQARRRMLGNIRFIGELFK
FT                   KEMLTARIMHTCIMKLLNEKKNPDEEDVEALCKLMATIGRLIDRPDAKSHMDAYFKRIQ
FT                   GLSVNKSISSRHRFMCQDIMEMRSKGWRERRKQEGPKKIEDVHKDA"
     cgcgcgttca agtcgatcct caacaagctc acgccgcaga actttgagaa gctcctcgag        60
     caggttctcg ccgagggcat cgacgaggcg cagaccctca tcggcctcat cggtcagctc       120
     ttcgacaagg cgctcaccga gcccacgttc gcggagctgt acgcgatgat gtgccagcag       180
     ctgagcaaca ggttcctcgc cgagaacatc gagtttgtcg acccggattg cgacccagac       240
     gccgagggcg gaccgcggat gatcaacttt aagcgcgtgc tgctgaacaa gtgccaggag       300
     gagttcgaga agggcgactc cgcgatcaag gctgaggaga aggaggaggg cgaggtgccc       360
     gccaagccca agactccgga ggagctcgag ctcgacgagc gacgcaagat tcagcagcgc       420
     gaggaccgca tgaggcaggc gcgccggcgc atgctcggga acatccgctt catcggcgag       480
     ctcttcaaga aggagatgct caccgcgcgc atcatgcaca cgtgcatcat gaagctgctc       540
     aacgagaaga agaaccccga cgaggaggat gtcgaggcgc tgtgcaagct catggcgaca       600
     atcggtcggc tcatcgacag gcccgacgcc aaatcccaca tggacgccta cttcaagcgc       660
     atccagggcc tgtccgtcaa caagtccatc tcctccaggc acaggttcat gtgccaggac       720
     atcatggaga tgcgatccaa gggctggcgc gagcgcagaa agcaggaggg tcccaagaag       780
     attgaggacg tccacaagga tgcc                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page