(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE29

MICSR_1.PE29         Location/Qualifiers
FT   CDS_pept        49931..51466
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636034"
FT                   /orf_name="MICPUN_56601"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="ACO61598.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000199AB25"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q6"
FT                   /transl_table=1
FT                   /translation="MTTTSLAAGAVAVPRAMRVGARVSRRRSIARRRTLTTPRAGFLDD
FT                   MGVGDLGTSSPSSSAPVELANSIGSAVGRTYTELFPDLPSEVLGVSVPDTARALADAAR
FT                   PATDAAFQTLPDDAKSGLSDWWQREVDSGFTLVTGNAEYELALALLVFLWATGRPGVFG
FT                   GAFDAYFANAFDAVLLNKKFDKDSIKIRGKLGDGSFGSVSYAEDTDTGRELVVKQAKSV
FT                   QGAAQLQNAEEYMNRRVRRAPLVASGCAKYLGSYEVVEGASSPTLVWAFEGDVTLEELI
FT                   VRRDFPECVEELLYGGAQGGDDYAKRTSKVAKSVLRNLLSTLAGLHDIGIVHRDVKPAN
FT                   LVFMGRKFKLVDFGAAADLRTGKNYEPEQGLLDPFYSPPENFIMPERIPAPPPLRPLTA
FT                   SLSPLVWGTFLPDLFDSFSAGLVFLQMCVPQLRGRKVMDPNGSFRRLLEENNYDLRKWR
FT                   KVVEPQGWDFSALDANLGLGWDLACRLVCKRNFLQRGRLGCNTALLHPFFWTP"
     atgacgacga cgtcgttggc cgcgggcgcc gtcgcggtcc cgcgcgcgat gcgcgttggc        60
     gctcgcgtga gtcgacgccg gtcgatcgcg cggcgccgaa cactcaccac cccgcgcgcc       120
     ggcttcctcg acgacatggg cgtcggggac ctcgggacct catccccgtc gtcctccgcg       180
     ccggtggagc tggcgaactc gatcgggagc gccgtcggtc gcacgtacac cgagctcttc       240
     ccggacctgc cctccgaggt tctcggcgtg agcgtcccgg acaccgccag ggccctcgcg       300
     gacgccgcca gacccgccac tgatgccgcg ttccaaacct tacccgacga cgcaaagtcg       360
     ggcctgtccg attggtggca gagggaggtg gacagcgggt tcacgctcgt caccggcaac       420
     gccgagtacg agctcgcgct cgcgcttctc gtgttcctgt gggccacggg caggcccggc       480
     gtgttcggcg gggcgttcga tgcctacttc gccaacgcgt tcgacgcggt gctgctgaac       540
     aaaaagttcg acaaggattc aatcaagata aggggcaagc tcggggacgg ttcgttcggg       600
     tccgtgtcgt acgcggagga cacggacacg ggcagggagc tcgtggtcaa gcaggcgaag       660
     agcgtgcagg gcgccgcgca gctccagaac gcggaggagt acatgaacag gagggtgcgc       720
     cgcgcgccgc ttgtggcgtc gggttgcgcc aagtacctgg gctcttacga ggtcgtcgag       780
     ggcgcgtctt cgccgacgct ggtgtgggcg ttcgagggtg acgtgacgct cgaggagctc       840
     atcgtccgac gggatttccc cgagtgcgtg gaggagctgc tgtacggcgg ggctcagggc       900
     ggggacgact acgccaaacg cacgagcaag gttgccaaat ccgtgctgag gaacctgctg       960
     tccacgctgg ctggtctgca cgacattggc atcgtgcaca gggacgtcaa gcccgctaac      1020
     ctggtgttca tggggcgcaa attcaagctc gtggactttg gtgccgcggc tgatctcagg      1080
     acgggcaaaa actacgagcc agagcagggt ctgctggatc cgttttactc cccgccggag      1140
     aatttcatca tgccggagag gatcccggcg ccgccaccgc tgcgaccgct gaccgcgtcg      1200
     ctgtcgcccc tggtgtgggg tacgttcctc cccgaccttt tcgactcgtt ctccgcgggc      1260
     ctggtatttc tgcagatgtg cgtgccccag ctgagggggc gcaaggtgat ggaccccaac      1320
     gggtcgttcc gtcgactcct cgaggagaac aactacgacc tgaggaagtg gaggaaggtg      1380
     gtggagccgc agggctggga tttctcggct ctggacgcga acctcgggct gggatgggac      1440
     ctcgcgtgca ggttggtttg caagcggaac ttcctgcagc gcggcaggct ggggtgcaac      1500
     acagcactgc tccacccgtt cttctggacg ccataa                                1536
//

If you have problems or comments...

PBIL Back to PBIL home page