(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE290

MICSR_1.PE290        Location/Qualifiers
FT   CDS_pept        join(573237..574382,574702..575210,575665..576526)
FT                   /codon_start=1
FT                   /gene_family="HOG000218327" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636920"
FT                   /orf_name="MICPUN_79594"
FT                   /product="Predicted protein"
FT                   /function="3'-5'-exoribonuclease activity"
FT                   /function="RNA binding"
FT                   /function="polyribonucleotide nucleotidyltransferase
FT                   activity"
FT                   /biological_process="RNA processing"
FT                   /biological_process="mRNA catabolic process"
FT                   /cellular_component="mitochondrion"
FT                   /protein_id="ACO61738.1"
FT                   /db_xref="GO:0000175"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004654"
FT                   /db_xref="GO:0005739"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0006402"
FT                   /db_xref="HOGENOM:HBG382411"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniParc:UPI000199A5D7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G7"
FT                   /transl_table=1
FT                   /translation="MRARAPRIGAARSAGVQPCPRVVAPNGRRRPVRCAAAGAPDDPYA
FT                   ALDRTPKTLTLRIGESEVTVETGRIGRQANGAVMVTEGETVIYATICAGRDVTADGGFV
FT                   PLTVNYQERYSAVGRTAGGYRKRDGGVRENETLIGRLVDRPLRPMIPKGWAYDTQILEW
FT                   VLSYDGARSTDALAITAASCAAAISDVPLKKPIAGVRVGLLPGETEPLINPTCEQMERS
FT                   RLDLVLAGTEDAVMMIEGFGDFLTTQEMLYAIEKGHEAVANACRDIDAWAKDVGRVKNE
FT                   AAVLVAPEGVDDAVRALVGAELAEAMAISVKQTRGAAVEGIRARAIESLAGGDDAKFTV
FT                   SAVRRPAQSLRFAFCALLLFSLFPPGPRAFSRPFVRLPPPALENDVRLACGRCESNALR
FT                   SMIRANGVRQDGRDTKTVRPITCSGGLLPRTHGSSLFTRGETQAIAAATLGGATDAQKV
FT                   DGLGNDKDRRFYLHYFFPPSSVGETGRVGAASRREVGHGNLAERALMPVIPPYDDFPFT
FT                   VRLESTITESNGSSSMATVCAGSLALQDAGVPITRKVAGIAMGLILGDESAGEAPVILT
FT                   DILGSEDALGDMDFKVAGDGDGISAFQMDIKVEGITLAVLREALESARVGLVHILGEMD
FT                   KADPAPAGRMSAYAPQVEVVEVPTKYIGKVIGKGGEQIKAICEQTKIDTIDINEEGVVT
FT                   LTGSFGCDMPKAVEIIRSLTVEPEVGKTYRNARVTKVLDFGAFVEILPGVEGLCHVSEL
FT                   DVTRVANVRDVVEEGQTIDVKLLETNERGQFKLSRRAVLLDEGGEKVRRELAEAKVAAG
FT                   GDDADDAPGRGRPPPKARRGRSRLRE"
     atgcgcgccc gcgcgccgcg catcggcgcc gcgaggtccg cgggagtcca gccgtgcccg        60
     cgcgtcgtcg ccccgaacgg ccgccggcgc ccggtgcgtt gcgccgcggc gggcgccccg       120
     gacgacccgt acgcggcgct ggacaggacc ccaaagacgc tcaccttacg aatcggcgag       180
     agcgaggtca ccgtcgagac cggtcgcatc ggccgccagg ccaacggcgc ggtcatggtc       240
     accgagggcg agactgtgat ttacgccacc atctgcgcgg ggcgcgacgt caccgccgac       300
     gggggcttcg tcccgctgac cgtcaactac caggagcggt acagcgcggt cggccggacc       360
     gcgggcggct accgcaagcg cgacggcggc gtgcgcgaga acgagaccct catcgggcga       420
     ctcgtggacc gaccgctccg tccgatgatc ccaaaggggt gggcctacga cacgcagatc       480
     ctcgagtggg tgctctcgta cgacggcgca cgaagcacgg acgcgctcgc catcaccgcc       540
     gccagctgtg ccgcggcaat ctcggacgtc ccgctcaaga aacccatcgc cggcgtgcgc       600
     gtgggtttgt taccgggaga gacggagccc ctcatcaatc ccacgtgcga gcagatggag       660
     cgttcgaggc tggacctcgt cctcgccggc accgaggacg cggtgatgat gatcgagggg       720
     ttcggcgatt tcctcaccac gcaggagatg ctctacgcca tcgagaaggg ccacgaggcg       780
     gtggcgaacg cgtgcaggga catcgacgcc tgggccaagg acgtcggccg agtcaagaac       840
     gaagccgccg tcctcgtcgc gcccgagggg gtcgacgacg cggtgcgggc gctcgtcggc       900
     gcggagctcg cggaggcgat ggcgatcagc gtgaagcaga cgcgcggcgc cgcagtggag       960
     ggcatccgcg ccagggcgat cgagtcattg gcgggcggcg acgacgcgaa gttcacggta      1020
     agcgcggttc gacgtcccgc tcaaagtttg cgttttgcgt tttgcgcttt gctcctcttt      1080
     tccctcttcc ccccggggcc ccgggctttt tcgcgtccgt tcgtccgtct cccccccccg      1140
     gcactcgaaa atgacgtgag gctcgcgtgc ggtcggtgcg agtcgaacgc gctgcgctcc      1200
     atgatccgcg cgaacggcgt gcggcaagac gggcgcgaca ccaagacggt ccgccccatc      1260
     acctgctccg gcggcctcct cccgagaact cacgggtcct ccctgttcac ccgcggggag      1320
     acccaggcga tcgcggcggc gactttgggg ggagcgacgg atgcgcagaa ggttgacggc      1380
     ctcggcaacg acaaggacag gaggttttac ctccactact tcttcccgcc gtcctcggtg      1440
     ggcgagaccg gtcgcgtggg agcggccagt cgcagggagg tgggccacgg gaacctcgcg      1500
     gagagggcgc tcatgccggt catccccccg tacgacgatt tccccttcac cgtgaggctg      1560
     gagtccacaa tcacggagag caacgggagc tcgtcgatgg cgacggtgtg cgccgggtcg      1620
     ctcgcgctgc aagacgcggg ggtgccaatc acacggaaag ttgcgggcat cgccatgggt      1680
     ctcatcctcg gcgacgagtc cgcgggcgaa gctcccgtga tcctcaccga catcctcgga      1740
     agcgaggacg ccctgggaga tatggacttc aaggtggcgg gcgacggcga cggcatctcc      1800
     gcttttcaga tggacatcaa ggtcgagggc atcaccctcg ccgtgctgcg cgaggcgttg      1860
     gaatcggctc gcgtcggcct ggttcacatc ctcggcgaga tggacaaggc ggacccggct      1920
     cccgcgggcc ggatgagcgc gtacgctccg caggttgagg tggtcgaggt gcccacgaag      1980
     tacatcggca aggtgatcgg gaaaggcggc gagcagatca aggccatctg cgagcagacc      2040
     aagatcgaca ccatcgacat caacgaggag ggagtcgtca ccctcaccgg ttcctttggc      2100
     tgcgacatgc ccaaggcggt ggagatcatc aggagcctca ccgtcgagcc cgaggttggc      2160
     aagacgtaca ggaacgcgag ggtgaccaag gttctcgatt tcggcgcctt cgtcgagatc      2220
     ctccccggcg tcgagggtct gtgccacgtc agcgaactgg acgtcacgcg cgtggcgaac      2280
     gtccgcgacg tcgtcgagga gggtcagacg attgacgtga agctgctgga gacgaacgag      2340
     cgcgggcagt tcaagctgag caggcgcgcg gtgctgctcg acgagggcgg ggagaaggtc      2400
     aggcgggagc tggccgaggc gaaggtcgcc gccggcggtg acgacgccga cgacgcgccg      2460
     ggacggggaa gaccgccgcc gaaggcgaga cgcgggcgaa gccgcctccg ggagtga         2517
//

If you have problems or comments...

PBIL Back to PBIL home page