(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE291

MICSR_1.PE291        Location/Qualifiers
FT   CDS_pept        complement(576679..580467)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636921"
FT                   /orf_name="MICPUN_56867"
FT                   /product="Predicted protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="ACO62165.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI000199A64E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G8"
FT                   /transl_table=1
FT                   /translation="MAGSFEATLSVSDRPELTSLAVTAVPIDPPAVERAAAGDGTTDRR
FT                   DPEHGVGGKGKNNGNEEDASTGARPEKQRKSSEREESVSDDEDQPDDDGLHAAAKKGMN
FT                   VVGWWRAKLNANHGLDKEILAALHLLAGARGPCMRLAFSHPVLSQPGDSDARRRNKEGL
FT                   TKLHREMRAEQKSAVMFLDDPATGRRREVHLAAVWVHPADTAGDTAGDAVGSNGADEAA
FT                   LTTNDEAAPTTNDDGDKADAREPQFLAFEVQPNAPAVALEPLLHKQLMVVFDLDETLLQ
FT                   AFTLRAMERRARELDAEDAGADGGADGGADGGADDAATSGWGGGGRGDPGKNTAGVPGA
FT                   VGGDARAATRDAKELAARRDEDRRRLRRDAELLTQFRDGDCVKMPVPGSATGTTQTVRA
FT                   KMEPVLVLDEERYGPSPVTVARPVIRVKSPHVRGGEMVFTRIDPKNVDTSMIVHVRPGW
FT                   NDLYAYLTGEASQAQAPNAVRGVNKENPAHRPRRPKCKAFVCTMSERQYAHEMWRLLDP
FT                   RGALLPLNDVHALHKRIVCVEHGRGEKKSLAHATRGATHVPELSVIVDDRTNVWERRAQ
FT                   KNILAIAPFMPYNTDTGPGLQSEVAGKGGVMGMVQSMLNEVRFKFSQQWTRWAQRCDRG
FT                   DPLRPGGERPDAGEILAPLMASWAEDNTATIVRQGGAARAAAGAGSSLNAVLKSLGRSK
FT                   SNAEEAQRRRDAEAKAKAEEEERAKAEEERAREEERVREEEKQRRWLEEAQAKLKEEER
FT                   ARAEEQRRLLQETEAKVEEQRRLLQETEAKFKEQTRLLKEAEAKVNRARMDDALAAITY
FT                   ESLAATPLEAKGKRPVKAKTEVKTATAGDVDGLGTDSDDSDDAPIAAMAAEPKRPTAED
FT                   EKRRSDEEAKRKKQVRNCQQCSQWGIRAVDHFKSCKMCPFHKDYVHPKHDDDARRRLFE
FT                   RLVELRWSSSAEKAIEGATRLVEKFQPTAIKDGNIEVGELEDAVATRLLRFVLTRQGNP
FT                   AAAPPAAAAPPAAAATLAAAAPAEESEGKSVKKPEPKKRKSGEISKQPKGGGKEAPLLG
FT                   VADGYVKKHKSLKEIIEMKEKSEVVEIEEEQEEEEEEEEIDHGPCVLCGIKDQNEMLCD
FT                   GCDRPFHNSCVNISDEELEIMIEAEEDWFCEDCVKSGKNAGANDEMREHKLKKMDKADS
FT                   DFNLDARDEVEFIKGTRGNPGAASRVRQEKKKASGQAPGPAPAEGAREVHPKDEETGET
FT                   EELAPKPSPSKSVASKYKPGTQREAMMKKLKKIGKRR"
     atggcgggct cgttcgaggc tacgctgtcg gtgagcgatc gccccgagct tacatcgctc        60
     gcggtgacgg ccgtccccat cgatccgccg gcggtcgagc gcgcggcagc gggtgacggg       120
     acgaccgacc gccgcgaccc cgagcacggg gtgggcggaa aaggaaaaaa caacggaaac       180
     gaagaggacg cctccaccgg cgcgcgtccg gagaagcagc gcaaaagctc ggagcgggaa       240
     gaatccgtca gcgacgatga ggaccagccg gacgacgacg ggctgcacgc ggcggcgaag       300
     aagggcatga acgtggtcgg ttggtggaga gccaagctca acgcgaacca cgggctcgat       360
     aaggagatcc tcgccgccct gcacctcctc gcgggggcgc gcgggccgtg catgcgcctc       420
     gccttctcgc atccggtcct ctctcaaccg ggtgactcgg acgctcgcag acgcaacaag       480
     gagggcctca ccaagctcca tcgggagatg cgcgccgagc agaaatccgc ggtgatgttc       540
     ctcgacgatc ccgccacggg gcgcaggcgc gaggtgcacc tcgcggcggt ctgggtccat       600
     cccgccgaca cggctggcga cacagctggc gacgccgtgg gatcaaacgg cgccgacgaa       660
     gccgccttga cgacgaacga cgaagccgct cccacgacga acgacgacgg cgacaaggcg       720
     gacgcgcgag agccgcagtt tctcgcgttc gaggttcaac ccaacgcccc cgcggtggcg       780
     ctcgagcccc tgctgcacaa gcagctcatg gtcgtcttcg acctcgacga gacgctcctg       840
     caggcgttta cgcttcgcgc catggagcgc cgcgcgaggg agctggacgc cgaggacgcg       900
     ggtgccgatg ggggtgccga cgggggtgcc gacgggggtg ccgacgacgc cgcgacgagc       960
     gggtggggcg gcggcggacg gggagacccc gggaaaaaca cagctggcgt ccccggcgcg      1020
     gtgggcggcg acgcgagagc cgcgactcgc gacgccaagg agctcgcggc gcgtcgcgac      1080
     gaggaccgcc ggcggctgcg acgcgacgcc gagctgctga cgcagtttcg cgacggggac      1140
     tgcgtcaaga tgccggtgcc ggggagcgcc accgggacga cgcagacggt gcgggcgaag      1200
     atggagccgg tgctggtact cgacgaggaa cggtacggtc cctcgcccgt caccgtcgcc      1260
     agacccgtca tccgcgtcaa gtccccgcac gttcggggcg gggagatggt gttcaccagg      1320
     atcgacccga agaacgtaga caccagcatg atcgtccacg tgcgaccggg gtggaacgac      1380
     ctgtacgcct acctcaccgg cgaggcgtcc caggctcagg ctccgaacgc cgtcaggggc      1440
     gtgaacaagg aaaatcccgc gcatcgcccg cggcggccca agtgcaaggc tttcgtgtgc      1500
     accatgtccg agcggcagta cgcgcacgag atgtggcgcc tgttggaccc gcgcggcgcc      1560
     ctgcttcccc tgaacgacgt ccacgcgctt cacaaacgga tcgtgtgcgt cgagcacggg      1620
     cgcggggaga agaaatcgtt ggcgcacgcg accaggggcg cgacgcacgt tccggagctg      1680
     agcgtcatcg tcgacgatag gacgaacgtc tgggagcgtc gggcgcagaa gaacatcctc      1740
     gcgatcgcgc cgttcatgcc gtacaacacc gacaccggcc cgggactcca gagcgaggtg      1800
     gcggggaagg gcggggtgat ggggatggtg cagagcatgc tgaacgaggt gcggtttaaa      1860
     ttttctcagc agtggacgcg atgggcgcag cgctgcgacc ggggcgatcc gctgcgaccg      1920
     gggggcgaga gaccggacgc gggcgagatc ctcgcgccgc tcatggcgtc gtgggcggag      1980
     gacaacacgg cgacgatcgt gaggcagggg ggcgccgcga gggcggcggc tggcgccggg      2040
     tcgagcctga acgcggtgct caagtccttg ggccggtcca aatccaacgc cgaggaggcg      2100
     cagcggaggc gggacgcgga ggccaaggcg aaggctgagg aggaggagag ggccaaggct      2160
     gaggaggaga gggccaggga ggaggagagg gtcagggagg aggagaagca gaggcggtgg      2220
     ttggaggagg cccaggctaa gttgaaggag gaagagaggg ccagggccga ggagcagagg      2280
     cggttgttgc aggagaccga ggcgaaggtt gaggagcaga ggcggttgtt gcaggagacc      2340
     gaggctaagt ttaaggagca gacgcggttg ttgaaggagg ccgaggctaa ggtgaatcgg      2400
     gcccggatgg acgacgctct cgcggcgata acttacgaaa gtctcgcggc gacgccgttg      2460
     gaagcaaagg gaaaacgacc cgtgaaggca aagaccgagg tcaagaccgc gaccgcgggg      2520
     gatgtggacg gattgggaac ggactcggac gactccgacg acgcgccgat cgcggccatg      2580
     gcggcggagc ccaagagacc gactgccgag gacgagaagc gccggagcga cgaggaggcc      2640
     aagcgtaaga aacaggttcg caactgccag cagtgcagcc agtggggcat acgcgccgtg      2700
     gaccacttca agtcttgcaa gatgtgtcct ttccacaagg attacgtcca cccgaagcac      2760
     gacgacgacg cgcggaggcg actgttcgag cggctggtcg agctccgctg gtcgagctcc      2820
     gcggagaagg caatcgaggg cgccacgaga cttgtcgaga agttccagcc gacggctatc      2880
     aaggacggga acatcgaggt cggcgagctc gaggatgcgg tcgcgacgcg gctcctcagg      2940
     ttcgtgctca cgaggcaggg caatcccgca gccgccccgc ccgcagccgc cgccccgccc      3000
     gcagccgccg ccacgctcgc agccgccgcc ccggcggagg agtccgaggg gaagtccgtc      3060
     aaaaagcccg agccaaagaa gcgtaagtcc ggggagatat ccaagcagcc caagggcggc      3120
     ggcaaggaag ccccgctcct gggagtcgcc gatgggtatg tgaagaaaca caagagcctc      3180
     aaagagatca tcgagatgaa ggaaaagtcc gaggtcgttg agattgaaga agagcaggag      3240
     gaggaggagg aggaggagga gatcgatcac ggcccctgcg tcctatgcgg catcaaagac      3300
     cagaacgaga tgctctgcga cgggtgcgat cgaccgtttc acaactcgtg cgtcaacatc      3360
     tccgacgagg agctcgaaat catgatcgag gcggaggagg attggttctg cgaggactgc      3420
     gtcaagtccg gcaagaacgc gggcgcgaac gacgaaatgc gggagcacaa actcaaaaag      3480
     atggacaagg ccgactccga cttcaatctg gacgcgcgcg acgaggttga gttcatcaag      3540
     ggcacgcgcg gtaacccagg agctgcaagc agggttaggc aggagaagaa gaaggcgtcg      3600
     ggacaggcac cgggaccggc tccggcggag ggggctcgcg aggtccaccc gaaggatgag      3660
     gagacgggcg agacggaaga gctcgccccg aagcccagtc cgtccaagtc ggtggcgtcc      3720
     aagtataagc cgggcacgca acgagaggcg atgatgaaaa agttgaaaaa gattggaaag      3780
     cggcgttag                                                              3789
//

If you have problems or comments...

PBIL Back to PBIL home page