(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE292

MICSR_1.PE292        Location/Qualifiers
FT   CDS_pept        580947..582185
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636922"
FT                   /orf_name="MICPUN_99418"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61739.1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI000199A64F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G9"
FT                   /transl_table=1
FT                   /translation="MSIASGVASVPVGVPHATPRRGGPRNATAKPHIPRRPRLDAPSAW
FT                   AETSPSAPSSASSATASDARDDLPVRVYIEHTDAYQVVYHSNYFKFLWRAREAYVFGGG
FT                   LASALRHRTGAPFDPTAAGWDHLDVVAIDDCVFARSAVLGDDLLVRTSLRGIGETTLAM
FT                   RQEVVFADGGELAFAATAVVAPASATGATTIPREIRGWRAGDEDGIDGVDVGTGYEDPA
FT                   WLARASASASVEDAGDCSEDDEEANEDPEARVSSIATKTRVTLFESELSLGRARGASDA
FT                   DVLRWFERDRTEAIGGSSALSALKENDGVAVVVSSMDGFRCRPGNVVGSAGIGAGGASG
FT                   GRNVRPAVASARSTIEMRRRNIQVAFIQRLFDEAGACVARAEVVCTCVTRDGGKPTRCP
FT                   AALAEKFEAMRRG"
     atgtcgatcg cgtccggggt cgcgtccgtg cccgtcggtg tcccgcatgc gacgccgaga        60
     cgcggcggac cccgaaacgc gaccgcgaag ccccacatcc cgcgtcgtcc tcgcctcgac       120
     gcgccatccg catgggcgga gacgtccccg tcggcgccct cgtccgcctc ctccgcgacc       180
     gcttccgacg cccgcgacga ccttccggtc cgcgtgtaca tcgagcacac cgacgcgtac       240
     caagtcgtct atcacagcaa ctatttcaag ttcctgtggc gcgccaggga ggcgtacgtg       300
     ttcggaggag gcttggcctc ggcgctgcgc catcgcaccg gcgcaccctt cgacccgacc       360
     gccgccggtt gggatcacct cgacgtcgtc gccatcgacg actgcgtgtt cgccaggagc       420
     gcggtgctcg gcgacgacct cctcgtgcgc acatccctgc gaggcatcgg cgaaacgacg       480
     ctggcgatgc gacaggaggt ggtgtttgcg gatggcggcg agctcgcctt tgcggcgaca       540
     gctgtggtgg cgccggcttc ggcgacggga gcgacgacga ttccgcgcga gattcgcggg       600
     tggcgggcgg gggacgagga cgggatcgac ggggtcgacg tggggacggg gtacgaggac       660
     cccgcgtggc tcgcgcgggc gtcggcgtcg gcgtcggtcg aggacgcggg ggactgttcc       720
     gaggatgacg aagaagcgaa cgaggatccc gaagcgaggg tatcgtcgat cgcgacgaag       780
     acgcgggtga cgctgttcga gtcggagctg agcctcgggc gcgccagggg ggcgtcggac       840
     gcggacgtcc ttcgatggtt cgagcgcgac cgcacggagg ctatcggtgg atcaagcgcc       900
     ctgagcgccc tgaaggagaa cgacggggtc gcggtggtgg tgagctcgat ggatggattt       960
     cggtgtcgcc ccggtaacgt cgtcggatcc gcggggatcg gcgcgggcgg cgcgagcggc      1020
     ggtcggaacg tgcgccccgc ggtcgcgtcg gcgcggtcga cgatcgagat gcgtcgtcgg      1080
     aacatccagg tggcgttcat ccagcgtctg ttcgacgaag ccggcgcgtg cgtggcgagg      1140
     gccgaggttg tgtgcacgtg cgtgactcgc gacggcggca agccgacgcg ttgtccggcg      1200
     gcgttggccg agaagttcga ggcgatgaga cgcgggtga                             1239
//

If you have problems or comments...

PBIL Back to PBIL home page