(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE293

MICSR_1.PE293        Location/Qualifiers
FT   CDS_pept        583818..585401
FT                   /codon_start=1
FT                   /gene_family="HOG000222134" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636923"
FT                   /orf_name="MICPUN_79438"
FT                   /product="Predicted protein"
FT                   /function="glycerol kinase activity"
FT                   /biological_process="glycerol-3-phosphate metabolic process"
FT                   /protein_id="ACO61740.1"
FT                   /db_xref="GO:0004370"
FT                   /db_xref="GO:0006072"
FT                   /db_xref="HOGENOM:HBG511469"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniParc:UPI000199A650"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H0"
FT                   /transl_table=1
FT                   /translation="MAPKLVGAIDQGTTSTRFILYRVVGDGVLQPLASHQMEHKQIYPK
FT                   PGWCEHDPEEIYANTLTCIASALEAVPGGATASDVACVGITNQRETTVAWSKRTGKPLH
FT                   NAVVWLDMRTSDLCESLTSEVMGGDKDAFREVCGLPISTYFSGVKMRWLLDNCDAVKAA
FT                   AAENDLAFGTIDSWLLHRLTGSAGTHVTDATNASRTMLMDLRTQTWHEPTAVKLGVPMH
FT                   SLPRIVSCAEEYGVITEGALKGVKLTGCLGDQHAATLGQRCDAGRAKNTYGTGCFMLLN
FT                   TGGNVVESKHGLLTTMAWRLGKDATPAYALEGSVAIAGAGVQWLRDNLGLIRSAADVEP
FT                   LAASVPDAGGVYFVPAFSGLFAPRWRPDARGVCVGLTQFTTKAHLARALLEAICFQTVD
FT                   VLEAMRKDASDLDMTALHVDGGATANGLMMQTQADLLGLRVFRPANVETTAMGAALAAG
FT                   VGAGLFSERAVFEDTPADESIADAEWLRDEMANRAYFEPAIGEDERARRYAGWCDAVER
FT                   SLNLAPQQGK"
     atggccccta agctcgtcgg cgcgatcgac cagggcacca cgtccacgcg gttcatcctc        60
     taccgcgtcg tcggcgatgg cgtcctccag cctctggcat cgcaccagat ggagcacaag       120
     cagatctacc ccaagcccgg ctggtgcgag cacgatccgg aggagatcta cgccaacacc       180
     ctgacgtgca tcgcgagcgc cctcgaggcg gtgccggggg gcgcgaccgc gtccgacgtg       240
     gcgtgcgtgg gcatcaccaa ccagcgcgag accaccgtgg cgtggtctaa gcgcacggga       300
     aagccgctgc acaacgcggt ggtgtggctg gacatgcgaa cctctgacct gtgcgagtcc       360
     ctcacgagcg aggtcatggg cggcgacaag gatgcgtttc gcgaagtctg cggactcccc       420
     atcagcacct acttctccgg ggtgaagatg cgctggctcc tcgataattg cgacgccgtc       480
     aaggccgccg cggcggagaa cgacctcgcc ttcgggacca tcgacagctg gctgctgcac       540
     aggctcacgg gttcggccgg gacgcacgtc accgacgcca ccaacgcgtc gcggaccatg       600
     ctcatggacc tccgcaccca gacttggcac gagcccacgg cggtgaaact gggcgtgccg       660
     atgcactccc tgccacgcat cgtgtcgtgc gcggaggagt acggagtcat caccgagggc       720
     gccctgaagg gggtcaagct cacggggtgc ctcggcgatc agcacgcggc gacgctgggc       780
     cagagatgcg acgcggggcg cgccaagaac acgtacggca cgggttgctt catgctcctc       840
     aacaccggcg gaaacgtcgt ggaatccaaa cacgggctgc tgaccacgat ggcgtggcgg       900
     ctgggtaagg acgcgacgcc ggcgtacgcg ctggagggca gcgtcgccat cgccggcgcc       960
     ggggtccagt ggctgaggga taacctcggg ttgatacgat ccgcggcgga cgtcgagccg      1020
     ctcgccgcct ccgtccccga cgcgggtggc gtgtacttcg tgcccgcgtt ctccggcctg      1080
     ttcgcgccca ggtggagacc cgacgcgcgg ggcgtgtgcg tggggctgac gcagttcacc      1140
     acgaaggcgc acctcgcgcg agcgctcctc gaggcgatct gctttcagac ggttgacgtc      1200
     ctcgaggcta tgcgaaagga cgcgagcgac ctcgacatga ccgcgcttca cgtcgacggg      1260
     ggagccaccg cgaacgggtt gatgatgcag acccaggcgg atctgctcgg gctgagggtg      1320
     ttccgcccgg cgaacgtgga gacgaccgcg atgggcgcgg cgctcgcggc gggtgtcggc      1380
     gccgggctct tttcggagag agccgtcttt gaggatacac ccgccgacga gtcaatcgcc      1440
     gacgcggagt ggctgaggga cgagatggcg aatcgagcgt acttcgaacc cgcgatcggg      1500
     gaggacgaga gggcgaggcg gtacgcgggc tggtgcgacg cggtggagcg aagcctcaac      1560
     ctggcgccgc agcagggcaa gtga                                             1584
//

If you have problems or comments...

PBIL Back to PBIL home page