(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE294

MICSR_1.PE294        Location/Qualifiers
FT   CDS_pept        complement(585505..587073)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636924"
FT                   /orf_name="MICPUN_107903"
FT                   /product="Predicted protein"
FT                   /function="metalloendopeptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO62166.1"
FT                   /db_xref="GO:0004222"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="UniParc:UPI000199A651"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H1"
FT                   /transl_table=1
FT                   /translation="MKTLHEETLHVVNLVNLLFRKDIKTPVTIVVKRLYDAKDPWKDEV
FT                   PIQADGEAVSLKLLDAFTNWRTKLYDDLPSHDSAHLFSGHDFDGETVGLANQIGDTGVS
FT                   ICSDYYCGWDVGGQKLKPGFCFCEQLNGVCQDKLNCCSMASTGISMVRKEKLASDATTV
FT                   AHEIGHKLGFPHDGVKEGGVDTTRCDKTGYIMAASSSSTDEFDSWSQCSVDKFAAALEG
FT                   DEYFCLAKGDHAVCGNMVVEDGEECDCGGSDCTAGMHPDPCCDGKTCKLVAGAKCSAGL
FT                   GDRGCCDPSTCSTRAAGHTCRPVDGLCDIEEKCDGVESTCPMDLHKEIGRGCEDSNGDV
FT                   GACLGKHCANRNHVCTSITQVRSDGLLYGGKSASQAAGKSYGGKKLWLFDSTSCDNGFV
FT                   CFDDANSVSQSTYWTLSNYGALPGFPCGSSTTVTRTTNGTNETYEIFENVCDGGPTLNG
FT                   QSSKCVTRPKMIPPPPAPFPPPSPPKAPWPPPAPPLPPYAGSPGVSTFRSTLFGVIAAL
FT                   ALLAH"
     atgaagacgc ttcacgagga gacgcttcac gtggtcaacc tggtgaatct gctgttcagg        60
     aaggacatca agacgcccgt gacgatcgtg gtcaagcgcc tgtacgatgc taaggacccg       120
     tggaaagatg aagtcccgat ccaggcagac ggggaggcgg tttcactcaa gcttctcgac       180
     gcatttacaa actggcgaac aaaactgtac gatgacctgc cgtcgcacga ttccgcacac       240
     ctcttcagcg gtcacgattt cgacggggag actgtcggac tggcgaacca gattggcgac       300
     acgggcgtga gcatatgcag cgattactat tgcggttggg atgtcggggg ccagaagcta       360
     aaacctgggt tttgcttctg cgagcaactc aacggcgtgt gccaggacaa gctgaactgt       420
     tgctccatgg cctccaccgg catatcgatg gtgcggaaag agaagctggc gtcggacgcg       480
     acgacggtgg cgcacgagat tggccacaaa ttaggatttc cgcacgatgg ggtgaaggag       540
     ggcggcgtcg acaccaccag gtgcgacaag actgggtaca tcatggcagc ctcgtcgagc       600
     tccaccgatg aatttgacag ttggtcgcag tgcagcgtgg acaagttcgc cgcggcgctc       660
     gagggtgacg agtatttctg cctggccaag ggagaccacg cggtgtgcgg caacatggtg       720
     gtggaggacg gcgaggagtg cgactgcggc ggctcggatt gcaccgcggg aatgcacccc       780
     gacccctgct gcgacgggaa gacgtgcaag ctggtggcgg gtgcgaagtg ctcggcgggc       840
     ctcggggatc gaggatgctg cgacccgagc acgtgctcga cgcgcgcggc gggtcacacg       900
     tgcaggcccg ttgacggtct gtgcgacatc gaggaaaagt gcgacggcgt cgagtccacg       960
     tgcccgatgg acctgcacaa ggagattggt cgggggtgcg aggattccaa cggggacgtg      1020
     ggcgcttgtc tggggaagca ctgcgcgaac cgtaaccacg tgtgcacgag cataacccaa      1080
     gttcgcagtg atggcctact gtatgggggc aaatcggcga gtcaggccgc gggcaaaagc      1140
     tatggtggca agaagttgtg gttgttcgac tccacctcct gcgacaacgg tttcgtatgc      1200
     ttcgacgatg ccaactcggt ttctcagtcg acttattgga ccctgtccaa ctacggcgcg      1260
     ttgcctgggt ttccgtgcgg ctcctcgacg acggtgactc ggacgacgaa cggaaccaac      1320
     gagacatacg agattttcga gaacgtgtgc gacgggggac cgacattgaa cgggcagagc      1380
     agcaaatgcg tcacgcgccc gaagatgatt ccgccgccgc cggcgccttt tccgcccccg      1440
     tcgccgccca aggcgccgtg gccgcccccc gcgccgcctt tgccgcctta cgccgggagt      1500
     cccggggttt cgacattccg gtcgacgctc ttcggcgtca tcgcggcgtt ggctctcctg      1560
     gcacattga                                                              1569
//

If you have problems or comments...

PBIL Back to PBIL home page