(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE295

MICSR_1.PE295        Location/Qualifiers
FT   CDS_pept        588253..589380
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636925"
FT                   /orf_name="MICPUN_56871"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61741.1"
FT                   /db_xref="UniParc:UPI000199A652"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H2"
FT                   /transl_table=1
FT                   /translation="MLAWIGARKNRAHRGGASTLAARYDLAVRASTSARGAKHERDEDQ
FT                   LACEDEELRPSVRRKASAALASSKPAATSLDVLDLHVLCHLMECERESSREKDKDDEAR
FT                   AALKPAEASRRASRSPCVKRAREESGDGDDDMELALEGLALSPSPPSPFGPTQGRPHTA
FT                   SSPCSPPEQLRTPGAFTLPSPPRKKIKPGLAPSLAPFASSPGRSWTTLGLDAGLGSILG
FT                   ARRTRPKACRSLDFSLPTLSESAGAERGTQLSSQDEGSFDEKDAIDVVMSHKYGRPEDV
FT                   MDADETDDAAADDDEEADATDAMEEDAENRRLRAVSLVDVDTRGGGVRQSARVDRGALM
FT                   EVMSAVGGGRTNASIGAVPWRVMKLMQIEEEIFII"
     atgttggcgt ggatcggcgc gaggaagaac cgcgcgcacc gcggcggcgc gtcgactctc        60
     gcagccaggt acgatctcgc cgttcgggcg agcacgagcg cgcggggggc aaagcacgag       120
     cgcgacgagg accagctggc gtgcgaggac gaggaacttc gcccctcggt cagacggaag       180
     gcgtccgccg cgctcgcttc gtcaaagccc gcggcgacct cgctggatgt cctcgacctg       240
     cacgtgctgt gccacctgat ggagtgcgag cgcgagtcgt cgcgcgagaa ggacaaggac       300
     gacgaagcga gggccgctct caagcccgcc gaggcgtccc gacgcgcgag ccgctcgccc       360
     tgcgtgaagc gtgcccgaga ggagtcgggt gacggagacg acgacatgga gctcgcgctg       420
     gaaggtctcg cgctgtcgcc ctcgcctcct tcgccgtttg ggcccacgca agggcgcccg       480
     cacaccgcat cctcgccgtg cagcccgccc gagcagctca ggacgcccgg cgctttcacg       540
     cttccgtctc cccctcggaa aaaaataaag ccggggctcg ctccttccct tgcgccgttc       600
     gcatcctcac ccgggcgctc ctggaccacg ctcggtctcg acgcgggact gggttccatc       660
     ctcggcgctc gccgaacgag gcccaaggcc tgccgcagcc tcgacttctc gctcccgacc       720
     ctctcggaga gcgcgggcgc cgagcgagga acacagctgt cgagccagga cgaagggagc       780
     ttcgacgaga aggacgcgat cgacgtggtg atgtcgcaca agtacggtcg acctgaggat       840
     gtcatggacg cagacgaaac cgacgacgcc gccgccgacg acgacgagga ggcggatgcg       900
     acggatgcga tggaagaaga tgcggagaac cgacgcctcc gcgccgtgag cctcgtcgac       960
     gtcgacaccc gaggcggcgg cgtcagacaa tcggcgcgcg tggacagggg cgcgctgatg      1020
     gaggtcatgt ccgcggtcgg gggcggtcgt acgaacgcgt cgatcggtgc ggtgccgtgg      1080
     cgcgtgatga agctgatgca gatcgaggag gagatcttca tcatctga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page